Overview

  • Product name

  • Description

    Mouse polyclonal to TIPE2
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Baboon
  • Immunogen

    Full length protein corresponding to Human TIPE2 aa 1-184.
    Sequence:

    MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYT HSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMT ALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHF SDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL


    Database link: AAH63014

  • Positive control

    • WB: TIPE2 transfected HEK-293T cell lysate.
  • General notes

    Protein previously known as Tumor necrosis factor alpha-induced protein 8-like protein 2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab169616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis.
  • Sequence similarities

    Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.
  • Domain

    The central region was initially thought to constitute a DED (death effector) domain. However, 3D-structure data reveal a previously uncharacterized fold that is different from the predicted fold of a DED (death effector) domain. It consists of a large, hydrophobic central cavity that is poised for cofactor binding.
  • Information by UniProt
  • Database links

  • Alternative names

    • AW610835 antibody
    • FLJ23467 antibody
    • Inflammation factor 20 antibody
    • Inflammation factor protein 20 antibody
    • TIPE2 antibody
    • TNF alpha-induced protein 8-like protein 2 antibody
    • TNFAIP8-like protein 2 antibody
    • TNFAIP8L2 antibody
    • TP8L2_HUMAN antibody
    • Tumor necrosis factor alpha induced protein 8 like 2 antibody
    • Tumor necrosis factor alpha-induced protein 8-like protein 2 antibody
    see all

Images

  • All lanes : Anti-TIPE2 antibody (ab169616) at 1 µg/ml

    Lane 1 : TIPE2 transfected HEK-293T cell lysate
    Lane 2 : Non-transfected HEK-293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 21 kDa

References

This product has been referenced in:

  • He B  et al. Construction of a lentiviral vector containing shRNA targeting ADAM17 and its role in attenuating endotoxemia in mice. Mol Med Rep 16:6013-6019 (2017). Read more (PubMed: 28849138) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up