Overview

  • Product name
  • Description
    Mouse polyclonal to TIPE2
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Baboon
  • Immunogen

    Full length protein corresponding to Human TIPE2 aa 1-184.
    Sequence:

    MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYT HSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMT ALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHF SDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL


    Database link: AAH63014

  • Positive control
    • WB: TIPE2 transfected HEK-293T cell lysate.
  • General notes

    Protein previously known as Tumor necrosis factor alpha-induced protein 8-like protein 2.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab169616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function
    Acts as a negative regulator of innate and adaptive immunity by maintaining immune homeostasis. Negative regulator of Toll-like receptor and T-cell receptor function. Prevents hyperresponsiveness of the immune system and maintains immune homeostasis. Inhibits JUN/AP1 and NF-kappa-B activation. Promotes Fas-induced apoptosis.
  • Sequence similarities
    Belongs to the TNFAIP8 family. TNFAIP8L2 subfamily.
  • Domain
    The central region was initially thought to constitute a DED (death effector) domain. However, 3D-structure data reveal a previously uncharacterized fold that is different from the predicted fold of a DED (death effector) domain. It consists of a large, hydrophobic central cavity that is poised for cofactor binding.
  • Information by UniProt
  • Database links
  • Alternative names
    • AW610835 antibody
    • FLJ23467 antibody
    • Inflammation factor 20 antibody
    • Inflammation factor protein 20 antibody
    • TIPE2 antibody
    • TNF alpha-induced protein 8-like protein 2 antibody
    • TNFAIP8-like protein 2 antibody
    • TNFAIP8L2 antibody
    • TP8L2_HUMAN antibody
    • Tumor necrosis factor alpha induced protein 8 like 2 antibody
    • Tumor necrosis factor alpha-induced protein 8-like protein 2 antibody
    see all

Images

  • All lanes : Anti-TIPE2 antibody (ab169616) at 1 µg/ml

    Lane 1 : TIPE2 transfected HEK-293T cell lysate
    Lane 2 : Non-transfected HEK-293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 21 kDa

References

ab169616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up