Overview

  • Product name

    Anti-Tissue Factor antibody
    See all Tissue Factor primary antibodies
  • Description

    Rabbit polyclonal to Tissue Factor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment within Human Tissue Factor aa 33-251. The exact sequence is proprietary.
    Sequence:

    SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCF YTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEF TPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKD LIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNR KSTDSPVECMGQEKGEFRE


    Database link: P13726

  • Positive control

    • Human gastric cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab182783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 33 kDa.
ELISA 1/1000 - 1/2000.
IHC-P 1/25 - 1/100.

Target

  • Function

    Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
  • Sequence similarities

    Belongs to the tissue factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD142 antibody
    • CD142 antigen antibody
    • Coagulation factor III (thromboplastin tissue factor) antibody
    • Coagulation factor III antibody
    • F3 antibody
    • FLJ17960 antibody
    • TF antibody
    • TF_HUMAN antibody
    • TFA antibody
    • Thromboplastin antibody
    • Tissue factor antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human breast carcinoma tissue labeling Tissue Factor with ab182783 at 1/25 dilution. The image on the right was treated with the immunogen.

References

ab182783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up