Overview

  • Product name

    Anti-Tissue Factor antibody
    See all Tissue Factor primary antibodies
  • Description

    Rabbit polyclonal to Tissue Factor
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Cow Tissue Factor aa 36-292. (Expressed in E.coli).
    Sequence:

    MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFTDVVVAYNITWKST NFKTILEWEPKPINHVYTVQISPRLGNWKNKCFYTTNTECDVTDEIVKNV RETYLARVLSYPADTSSSTVEPPFTNSPEFTPYLETNLGQPTIQSFEQVG TKLNVTVQDARTLVRANSAFLSLRDVFGKDLNYTLYYWKASSTGKKKATT NTNGFLIDVDKGENYCFHVQAVILSRRVNQKSPESPIKCTSHEKVLSTEL FFIIGTVMLVIIIFIVVLSVSLHKCRKVRAERSGKENTPLNAA


    Database link: P30931

  • Positive control

    • WB: Cow cerebrum and lung lysates; Recombinant cow Tissue Factor protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 32 kDa.

Target

  • Function

    Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
  • Sequence similarities

    Belongs to the tissue factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD142 antibody
    • CD142 antigen antibody
    • Coagulation factor III (thromboplastin tissue factor) antibody
    • Coagulation factor III antibody
    • F3 antibody
    • FLJ17960 antibody
    • TF antibody
    • TF_HUMAN antibody
    • TFA antibody
    • Thromboplastin antibody
    • Tissue factor antibody
    see all

Images

  • Anti-Tissue Factor antibody (ab231113) at 2 µg/ml + Recombinant cow Tissue Factor protein

    Predicted band size: 32 kDa

  • Anti-Tissue Factor antibody (ab231113) at 2 µg/ml + Cow cerebrum lysate

    Predicted band size: 32 kDa

  • Anti-Tissue Factor antibody (ab231113) at 2 µg/ml + Cow lung lysate

    Predicted band size: 32 kDa

References

ab231113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up