Overview

  • Product name

    Anti-Tissue Factor antibody [MM0700-21U4]
    See all Tissue Factor primary antibodies
  • Description

    Mouse monoclonal [MM0700-21U4] to Tissue Factor
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IPmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Tissue Factor aa 34-250.
    Sequence:

    GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFY TTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFT PYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDL IYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRK STDSPVECMGQEKGEFR


    Database link: P13726

Properties

Applications

Our Abpromise guarantee covers the use of ab201598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 33 kDa.
IP Use at an assay dependent concentration.

Target

  • Function

    Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.
  • Sequence similarities

    Belongs to the tissue factor family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD142 antibody
    • CD142 antigen antibody
    • Coagulation factor III (thromboplastin tissue factor) antibody
    • Coagulation factor III antibody
    • F3 antibody
    • FLJ17960 antibody
    • TF antibody
    • TF_HUMAN antibody
    • TFA antibody
    • Thromboplastin antibody
    • Tissue factor antibody
    see all

Images

  • Lane 1: Wild-type HAP1 whole cell lysate (40 µg)
    Lane 2: Tissue Factor knockout HAP1 whole cell lysate (40 µg)

    Lanes 1 - 2: Merged signal (red and green). Green - ab201598 observed at 49 kDa. Red - loading control, ab176560, observed at 50 kDa.

    ab201598 was shown to recognize Tissue Factor in wild-type HAP1 cells as signal was lost at the expected MW in Tissue Factor knockout cells. Additional cross-reactive bands were observed in the wild-type and knockout cells. Wild-type and Tissue Factor knockout samples were subjected to SDS-PAGE. Ab201598 and ab176560 (Rabbit anti-alpha Tubulin loading control) were incubated overnight at 4°C at 1/500 dilution and 1/20000 dilution respectively. Blots were developed with Goat anti-Mouse IgG H&L (IRDye® 800CW) preabsorbed ab216772 and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed ab216777 secondary antibodies at 1/20000 dilution for 1 hour at room temperature before imaging.

References

ab201598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up