Overview

  • Product name
    Anti-Tissue kallikrein antibody
    See all Tissue kallikrein primary antibodies
  • Description
    Mouse polyclonal to Tissue kallikrein
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Baboon, Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human Tissue kallikrein aa 1-262.
    Sequence:

    MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQC GGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPG FNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVG STCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCV GHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSY VKWIEDTIAENS


    Database link: NP_002248.1

  • Positive control
    • IHC-P: Human salivary gland tissue. WB: Tissue kallikrein transfected 293T cell line.
  • General notes

    Protein previously labeled as Kallikrein 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab169291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 29 kDa.
IHC-P Use a concentration of 3 µg/ml.

Target

  • Function
    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Tissue specificity
    Isoform 2 is expressed in pancreas, salivary glands, kidney, colon, prostate gland, testis, spleen and the colon adenocarcinoma cell line T84.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    The O-linked polysaccharides on Ser-93, Ser-104 and Ser-167 are probably the mucin type linked to GalNAc. In PubMed:3163150, GalNAc was detected with the corresponding peptides but not located.
  • Information by UniProt
  • Database links
  • Alternative names
    • Glandular kallikrein 1 antibody
    • hK 1 antibody
    • hK1 antibody
    • Kallikrein serine protease 1 antibody
    • Kallikrein-1 antibody
    • Kidney/pancreas/salivary gland kallikrein antibody
    • Klk 6 antibody
    • KLK1 antibody
    • KLK1_HUMAN antibody
    • Klk6 antibody
    • KLKR antibody
    • Tissue kallikrein antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human salivary gland tissue, labelling Tissue kallikrein with ab169291 at 3 µg/ml.

  • All lanes : Anti-Tissue kallikrein antibody (ab169291) at 1 µg/ml

    Lane 1 : Tissue kallikrein transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 29 kDa

References

ab169291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up