Overview

  • Product name

    Anti-Tissue kallikrein antibody
    See all Tissue kallikrein primary antibodies
  • Description

    Rabbit polyclonal to Tissue kallikrein
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Mouse Tissue kallikrein aa 25-261.
    Sequence:

    IVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVW LGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLL RLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCV NLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQ GITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND


    Database link: P15947

  • Positive control

    • Mouse kidney tissue.
  • General notes

    Protein previously labeled as Kallikrein 1.

Properties

Applications

Our Abpromise guarantee covers the use of ab191014 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 29 kDa.

The detection limit for Tissue kallikrein is approximately 0.5ng/lane under reducing conditions.

Target

  • Function

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Tissue specificity

    Isoform 2 is expressed in pancreas, salivary glands, kidney, colon, prostate gland, testis, spleen and the colon adenocarcinoma cell line T84.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    The O-linked polysaccharides on Ser-93, Ser-104 and Ser-167 are probably the mucin type linked to GalNAc. In PubMed:3163150, GalNAc was detected with the corresponding peptides but not located.
  • Information by UniProt
  • Database links

  • Alternative names

    • Glandular kallikrein 1 antibody
    • hK 1 antibody
    • hK1 antibody
    • Kallikrein serine protease 1 antibody
    • Kallikrein-1 antibody
    • Kidney/pancreas/salivary gland kallikrein antibody
    • Klk 6 antibody
    • KLK1 antibody
    • KLK1_HUMAN antibody
    • Klk6 antibody
    • KLKR antibody
    • Tissue kallikrein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded mouse kidney tissue tissue labeling Tissue kallikrein with ab191014 at 1 µg/ml.

References

ab191014 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Mouse Tissue lysate - whole (kidney, salivary gland, testis, liver)
Gel Running Conditions
Reduced Denaturing
Loading amount
20 µg
Specification
kidney, salivary gland, testis, liver
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Feb 08 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up