For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    titin-antibody-ab193218.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Epigenetics and Nuclear Signaling Chromosome Structure Chromosome
Share by email

Anti-Titin antibody (ab193218)

  • Datasheet
  • SDS
Reviews (1) Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Titin antibody (ab193218)

    Key features and details

    • Rabbit polyclonal to Titin
    • Suitable for: IHC-P
    • Reacts with: Mouse, Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    Assay
    Product image
    Cysteine Assay Kit (Fluorometric) (ab211099)
    Primary
    Product image
    Anti-heavy chain cardiac Myosin antibody [BA-G5] (ab50967)

    View more associated products

    Overview

    • Product name

      Anti-Titin antibody
      See all Titin primary antibodies
    • Description

      Rabbit polyclonal to Titin
    • Host species

      Rabbit
    • Tested applications

      Suitable for: IHC-Pmore details
    • Species reactivity

      Reacts with: Mouse, Human
    • Immunogen

      Recombinant fragment corresponding to Human Titin aa 5398-5604.
      Sequence:

      VGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWL KDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCS ALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELT LGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLD LIIPPSF


      Database link: Q8WZ42
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • Mouse heart tissue.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.40
      Constituents: 50% Glycerol (glycerin, glycerine), 49% PBS, 0.03% Proclin 300
    • Concentration information loading...
    • Purity

      Protein G purified
    • Purification notes

      >95%,Protein G purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Epigenetics and Nuclear Signaling
      • Chromosome Structure
      • Chromosome
      • Signal Transduction
      • Cytoskeleton / ECM
      • Cytoskeleton
      • Microfilaments
      • Actin etc
      • Actin Binding Proteins
      • Signal Transduction
      • Cytoskeleton / ECM
      • Cytoskeleton
      • Motor Proteins
      • Myosin
      • Cardiovascular
      • Heart
      • Hypertrophy
      • Other
      • Cardiovascular
      • Heart
      • Contractility
      • Contractile Proteins
      • Actins
      • Cardiovascular
      • Heart
      • Contractility
      • Contractile Proteins
      • Myosins

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

    Applications

    Our Abpromise guarantee covers the use of ab193218 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    IHC-P 1/20 - 1/200.

    Target

    • Function

      Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.
    • Tissue specificity

      Isoform 3, isoform 7 and isoform 8 are expressed in cardiac muscle. Isoform 4 is expressed in vertebrate skeletal muscle. Isoform 6 is expressed in cardiac tissues.
    • Involvement in disease

      Defects in TTN are the cause of hereditary myopathy with early respiratory failure (HMERF) [MIM:603689]; also known as Edstrom myopathy. HMERF is an autosomal dominant, adult-onset myopathy with early respiratory muscle involvement.
      Defects in TTN are the cause of familial hypertrophic cardiomyopathy type 9 (CMH9) [MIM:613765]. Familial hypertrophic cardiomyopathy is a hereditary heart disorder characterized by ventricular hypertrophy, which is usually asymmetric and often involves the interventricular septum. The symptoms include dyspnea, syncope, collapse, palpitations, and chest pain. They can be readily provoked by exercise. The disorder has inter- and intrafamilial variability ranging from benign to malignant forms with high risk of cardiac failure and sudden cardiac death.
      Defects in TTN are the cause of cardiomyopathy dilated type 1G (CMD1G) [MIM:604145]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
      Defects in TTN are the cause of tardive tibial muscular dystrophy (TMD) [MIM:600334]; also known as Udd myopathy. TMD is an autosomal dominant, late-onset distal myopathy. Muscle weakness and atrophy are usually confined to the anterior compartment of the lower leg, in particular the tibialis anterior muscle. Clinical symptoms usually occur at age 35-45 years or much later.
      Defects in TTN are the cause of limb-girdle muscular dystrophy type 2J (LGMD2J) [MIM:608807]. LGMD2J is an autosomal recessive degenerative myopathy characterized by progressive weakness of the pelvic and shoulder girdle muscles. Severe disability is observed within 20 years of onset.
      Defects in TTN are the cause of early-onset myopathy with fatal cardiomyopathy (EOMFC) [MIM:611705]. Early-onset myopathies are inherited muscle disorders that manifest typically from birth or infancy with hypotonia, muscle weakness, and delayed motor development. EOMFC is a titinopathy that, in contrast with the previously described examples, involves both heart and skeletal muscle, has a congenital onset, and is purely recessive. This phenotype is due to homozygous out-of-frame TTN deletions, which lead to a total absence of titin's C-terminal end from striated muscles and to secondary CAPN3 depletion.
    • Sequence similarities

      Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
      Contains 132 fibronectin type-III domains.
      Contains 152 Ig-like (immunoglobulin-like) domains.
      Contains 19 Kelch repeats.
      Contains 1 protein kinase domain.
      Contains 17 RCC1 repeats.
      Contains 14 TPR repeats.
      Contains 15 WD repeats.
    • Domain

      ZIS1 and ZIS5 regions contain multiple SPXR consensus sites for ERK- and CDK-like protein kinases as well as multiple SP motifs. ZIS1 could adopt a closed conformation which would block the TCAP-binding site.
      The PEVK region may serve as an entropic spring of a chain of structural folds and may also be an interaction site to other myofilament proteins to form interfilament connectivity in the sarcomere.
    • Post-translational
      modifications

      Autophosphorylated (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    • Cellular localization

      Cytoplasm. Nucleus.
    • Target information above from: UniProt accession Q8WZ42 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 7273 Human
      • Entrez Gene: 22138 Mouse
      • Omim: 188840 Human
      • SwissProt: Q8WZ42 Human
      • SwissProt: A2ASS6 Mouse
      • Unigene: 134602 Human
      • Unigene: 373672 Mouse
      • Unigene: 446279 Mouse
      • Unigene: 473358 Mouse
      see all
    • Alternative names

      • MPRM antibody
      • Cardiomyopathy dilated 1G (autosomal dominant) antibody
      • CMD1G antibody
      • CMH 9 antibody
      • CMH9 antibody
      • CMPD 4 antibody
      • CMPD4 antibody
      • Connectin antibody
      • DKFZp451N061 antibody
      • EOMFC antibody
      • FLJ26020 antibody
      • FLJ26409 antibody
      • FLJ32040 antibody
      • FLJ34413 antibody
      • FLJ39564 antibody
      • FLJ43066 antibody
      • HMERF antibody
      • LGMD2J antibody
      • MU RMS 40.14 antibody
      • MYLK5 antibody
      • Rhabdomyosarcoma antigen antibody
      • Rhabdomyosarcoma antigen MU RMS 40.14 antibody
      • Rhabdomyosarcoma antigen MU-RMS-40.14 antibody
      • Titin antibody
      • TITIN_HUMAN antibody
      • TMD antibody
      • TTN antibody
      see all

    Images

    • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Titin antibody (ab193218)
      Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Titin antibody (ab193218)

      Immunohistochemical analysis of paraffin-embedded mouse heart tissue labeling Titin with ab193218 at 1/50 dilution.

    Protocols

    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (1)

    Publishing research using ab193218? Please let us know so that we can cite the reference in this datasheet.

    ab193218 has been referenced in 1 publication.

    • Hahn JK  et al. The assembly and evaluation of antisense oligonucleotides applied in exon skipping for titin-based mutations in dilated cardiomyopathy. J Mol Cell Cardiol 131:12-19 (2019). PubMed: 30998980

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review

    Filter by Application

    Filter by Species

    Filter by Ratings

    Immunocytochemistry/ Immunofluorescence abreview for Anti-Titin antibody

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Dog Cell (Paraffin Heart)
    Permeabilization
    Yes - HIER - citrate buffer
    Specification
    Paraffin Heart
    Blocking step
    DAKO protein block as blocking agent for 10 minute(s) · Concentration: 100% · Temperature: RT°C
    Fixative
    10% NBF
    Read More

    Abcam user community

    Verified customer

    Submitted Nov 02 2016

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.