Tityustoxin K alpha, Kv 1.2 K+ channel blocker (ab141867)
Key features and details
- Potent Kv 1.2 K+ channel blocker
- CAS Number: 39465-37-7
- Purity: > 99%
Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
Tityustoxin K alpha, Kv 1.2 K+ channel blocker -
Description
Potent Kv 1.2 K+ channel blocker -
Biological description
Potent Kv1.2 K+ channel blocker (IC50 = 8 nM). Similar properties to a delayed rectifier. Active in vitro. -
Purity
> 99% -
CAS Number
39465-37-7 -
Chemical structure
Properties
-
Molecular weight
3942.00 -
Molecular formula
C168H275N49O46S7 -
Sequence
VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP (Modifications: Disulfide bonds: 7-28, 13-33, 17-35) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab141867 has not yet been referenced specifically in any publications.