Overview

  • Product name

  • Description

    Rabbit polyclonal to TJP2/ZO2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Recombinant fragment corresponding to Human TJP2/ZO2 aa 306-453.
    Sequence:

    IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKING TVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDI SEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG


    Database link: Q9UDY2

  • Positive control

    • WB: A431 cell lysate. ICC/IF: U-2 OS cells. IHC-P: Human colon tissue.
  • General notes

     This product was previously labelled as TJP2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 134 kDa.

Target

  • Function

    Plays a role in tight junctions and adherens junctions.
  • Tissue specificity

    This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.
  • Involvement in disease

    Defects in TJP2 are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities

    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization

    Cell junction > adherens junction. Cell membrane. Cell junction > tight junction. Nucleus. Also nuclear under environmental stress conditions and in migratory endothelial cells and subconfluent epithelial cell cultures.
  • Information by UniProt
  • Database links

  • Alternative names

    • C9DUPq21.11 antibody
    • DFNA51 antibody
    • DUP9q21.11 antibody
    • Friedreich ataxia region gene X104 (tight junction protein ZO-2) antibody
    • MGC26306 antibody
    • PFIC4 antibody
    • Tight junction protein 2 antibody
    • Tight junction protein ZO 2 antibody
    • Tight junction protein ZO-2 antibody
    • TJP2 antibody
    • X104 antibody
    • ZO 2 antibody
    • ZO-2 antibody
    • ZO2 antibody
    • ZO2_HUMAN antibody
    • Zona occludens 2 antibody
    • Zona occludens protein 2 antibody
    • Zonula occludens protein 2 antibody
    see all

Images

  • Anti-TJP2/ZO2 antibody (ab224314) at 1/100 dilution + A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 134 kDa

  • PFA-fixed/Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for TJP2/ZO2 (green) using ab224314 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human colon tissue stained for TJP2/ZO2 with ab224314 (1/50 dilution) in immunohistochemical analysis.

References

ab224314 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up