Overview

  • Product name

    Anti-TLE2 antibody
  • Description

    Rabbit polyclonal to TLE2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human TLE2 aa 407-604. (BC017364).
    Sequence:

    SSLPSIPGGKPAYSFHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAH GEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGAKTPVAQLDCLNRDNYI RSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVS PDAKVCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRL


    Database link: Q04725

  • Positive control

    • Rat lung lysate.

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab206147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 80 kDa (predicted molecular weight: 80, 67, 75 kDa).

Target

  • Function

    Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
  • Tissue specificity

    In all tissues examined, mostly in heart, brain, and muscle.
  • Sequence similarities

    Belongs to the WD repeat Groucho/TLE family.
    Contains 6 WD repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • enhancer of split groucho 2 antibody
    • enhancer of split groucho 2 antibody
    • Enhancer of split groucho-like protein 2 antibody
    • ESG antibody
    • ESG2 antibody
    • FLJ41188 antibody
    • GRG2 antibody
    • Groucho2 antibody
    • KIAA4188 antibody
    • MGC124808 antibody
    • mKIAA4188 antibody
    • Tle2 antibody
    • Tle2 protein antibody
    • TLE2_HUMAN antibody
    • transducin like enhancer of split 2 antibody
    • Transducin like enhancer of split 2, homolog of Drosophila E(sp1) antibody
    • Transducin like enhancer protein 2 antibody
    • Transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila) antibody
    • Transducin-like enhancer of split 2, homolog of Drosophila E(spl) antibody
    • Transducin-like enhancer protein 2 antibody
    see all

Images

  • Anti-TLE2 antibody (ab206147) at 1/500 dilution + Rat lung lysate

    Predicted band size: 80, 67, 75 kDa

References

ab206147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up