Overview

  • Product name

    Anti-TLK2 antibody
  • Description

    Rabbit polyclonal to TLK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TLK2 aa 23-234.
    Sequence:

    VGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQRNRKRKAEPYET SQGKGTPRGHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPLPR RVEQPLYGLDGSAAKEATEEQSALPTLMSVMLAKPRLDTEQLAQRGAGLC FTFVSAQQNSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALEN SKNSDLEKKEGR


    Database link: Q86UE8

  • Positive control

    • IHC-P: Human small intestine and testis tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Rapidly and transiently inhibited by phosphorylation following the generation of DNA double-stranded breaks during S-phase. This is cell cycle checkpoint and ATM-pathway dependent and appears to regulate processes involved in chromatin assembly.
  • Tissue specificity

    Widely expressed. Present in fetal placenta, liver, kidney, pancreas, heart and skeletal muscle. Also found in adult cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC44450 antibody
    • PKU alpha antibody
    • PKU-alpha antibody
    • Serine/threonine kinase antibody
    • Serine/threonine protein kinase tousled like 2 antibody
    • Serine/threonine-protein kinase tousled-like 2 antibody
    • TLK 2 antibody
    • tlk2 antibody
    • TLK2_HUMAN antibody
    • Tousled like kinase 2 antibody
    • Tousled-like kinase 2 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for TLK2 with ab224729 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for TLK2 (green) using ab224729 at 1/100 dilution in ICC/IF. Secondary: Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human small intestine tissue stained for TLK2 with ab224729 at 1/100 dilution in immunohistochemical analysis.

References

ab224729 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up