Overview

  • Product name

    Anti-TLL1 antibody [4H8C1]
    See all TLL1 primary antibodies
  • Description

    Mouse monoclonal [4H8C1] to TLL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TLL1 aa 870-1013. Expressed in E.coli.
    Sequence:

    SDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEW LLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSG PPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK


    Database link: O43897

  • Positive control

    • WB: Recombinant human TLL1 (AA: 870-1013) protein; TLL1 (AA: 870-1013)-hIgGFc transfected HEK-293 whole cell lysate. Flow: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
Flow Cyt 1/200 - 1/400.

Target

  • Function

    Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.
  • Involvement in disease

    Defects in TLL1 are the cause of atrial septal defect type 6 (ASD6) [MIM:613087]. A congenital heart malformation characterized by incomplete closure of the wall between the atria resulting in blood flow from the left to the right atria.
  • Sequence similarities

    Belongs to the peptidase M12A family.
    Contains 5 CUB domains.
    Contains 2 EGF-like domains.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ASD6 antibody
    • TLL antibody
    • TLL1 antibody
    • TLL1_HUMAN antibody
    • Tolloid like 1 antibody
    • Tolloid-like protein 1 antibody
    see all

Images

  • Anti-TLL1 antibody [4H8C1] (ab233827) at 1/500 dilution + Recombinant human TLL1 (AA: 870-1013)

    Developed using the ECL technique.


    Expected MW is 42.2

  • All lanes : Anti-TLL1 antibody [4H8C1] (ab233827)

    Lane 1 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 2 : TLL1 (AA: 870-1013)-hIgGFc transfected HEK-293 whole cell lysate

    Developed using the ECL technique.
  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cell line labeling TLL1 with ab233827 at 1/200 dilution (green) compared with a negative control (red).

References

ab233827 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up