Overview

  • Product name

    Anti-TLR10 antibody [ABM3C85]
    See all TLR10 primary antibodies
  • Description

    Mouse monoclonal [ABM3C85] to TLR10
  • Host species

    Mouse
  • Specificity

    Purified from tissue culture supernatant.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TLR10 aa 100-369.
    Sequence:

    YLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGL SGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPM DTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLL NKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVM RTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTK FQYLNFANNILTDELFKRTI


    Database link: Q9BXR5

  • Positive control

    • WB: Human ovary tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab228511 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 95 kDa.

Target

  • Function

    Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity

    Highly expressed in spleen, lymph node, thymus, tonsil and at lower levels in lung. Highly expressed in promyelocytic HL-60 cells and in B-cell lines.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 15 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 290 antibody
    • CD 290 antigen antibody
    • CD290 antibody
    • CD290 antigen antibody
    • MGC104967 antibody
    • MGC126398 antibody
    • MGC126399 antibody
    • OTTHUMP00000158729 antibody
    • OTTHUMP00000218162 antibody
    • TLR10 antibody
    • TLR10_HUMAN antibody
    • Toll like receptor 10 antibody
    • Toll-like receptor 10 antibody
    • UNQ315/PRO358 antibody
    see all

Images

  • Anti-TLR10 antibody [ABM3C85] (ab228511) at 2 µg/ml + Human ovary tissue lysate

    Developed using the ECL technique.

    Predicted band size: 95 kDa

References

ab228511 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab228511.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up