Overview

  • Product name

    Anti-TLR4/MD2 Complex antibody
    See all TLR4/MD2 Complex primary antibodies
  • Description

    Rabbit polyclonal to TLR4/MD2 Complex
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Horse, Cow, Macaque monkey
  • Immunogen

    Synthetic peptide within Human TLR4/MD2 Complex aa 650-700 (internal sequence). The exact sequence is proprietary.
    Sequence:

    LVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEG V


    Database link: O00206

  • Positive control

    • Human prostate tissue; Human intestine tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab218987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 95 kDa.

Target

  • Function

    Cooperates with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MYD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Also involved in LPS-independent inflammatory responses triggered by Ni(2+). These responses require non-conserved histidines and are, therefore, species-specific.
  • Tissue specificity

    Highly expressed in placenta, spleen and peripheral blood leukocytes. Detected in monocytes, macrophages, dendritic cells and several types of T-cells.
  • Involvement in disease

    Genetic variation in TLR4 is associated with age-related macular degeneration type 10 (ARMD10) [MIM:611488]. ARMD is a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 18 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Domain

    The TIR domain mediates interaction with NOX4.
  • Post-translational
    modifications

    N-glycosylated. Glycosylation of Asn-526 and Asn-575 seems to be necessary for the expression of TLR4 on the cell surface and the LPS-response. Likewise, mutants lacking two or more of the other N-glycosylation sites were deficient in interaction with LPS.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARMD10 antibody
    • CD284 antibody
    • CD284 antigen antibody
    • ESOP 1 antibody
    • ESOP1 antibody
    • Homolog of Drosophila toll antibody
    • hToll antibody
    • LY 96 antibody
    • LY96 antibody
    • Lymphocyte antigen 96 antibody
    • md 2 antibody
    • MD 2 protein antibody
    • MD2 protein antibody
    • Myeloid differentiation protein 2 antibody
    • Protein MD 2 antibody
    • Protein MD2 antibody
    • TLR 4 antibody
    • TLR4 antibody
    • TLR4_HUMAN antibody
    • TOLL antibody
    • Toll like receptor 4 antibody
    • Toll-like receptor 4 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human prostate tissue, labeling TLR4/MD2 Complex with ab218987 at 5 μg/ml.

  • All lanes : Anti-TLR4/MD2 Complex antibody (ab218987) at 0.1 µg/ml

    Lane 1 : Human intestine lysate
    Lane 2 : Human intestine lysate with Immunizing peptide

    Secondary
    All lanes : Goat anti-Rabbit Ig HRP

    Predicted band size: 95 kDa

References

ab218987 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up