Anti-TLR6 antibody [ABM1B50] (ab228424)
Key features and details
- Mouse monoclonal [ABM1B50] to TLR6
- Suitable for: Flow Cyt, WB
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-TLR6 antibody [ABM1B50]
See all TLR6 primary antibodies -
Description
Mouse monoclonal [ABM1B50] to TLR6 -
Host species
Mouse -
Tested applications
Suitable for: Flow Cyt, WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TLR6 aa 280-512.
Sequence:YLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFS EMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKL ETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVES IVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELN VAFNSLTDLPGCGSFSSLSVL
Database link: Q9Y2C9 -
Positive control
- WB: Jurkat whole cell lysate (ab7899). Flow Cyt: Jurkat cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: PBS, 0.05% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Clonality
Monoclonal -
Clone number
ABM1B50 -
Isotype
IgG1 -
Light chain type
kappa -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab228424 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
Flow Cyt | Use 0.5-1µg for 106 cells. | |
WB | Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 92 kDa. |
Target
-
Function
Participates in the innate immune response to Gram-positive bacteria and fungi. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR2. -
Tissue specificity
Detected in monocytes, CD11c+ immature dendritic cells, plasmacytoid pre-dendritic cells and dermal microvessel endothelial cells. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 12 LRR (leucine-rich) repeats.
Contains 1 LRRCT domain.
Contains 1 TIR domain. -
Cellular localization
Cell membrane. Cytoplasmic vesicle > phagosome membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10333 Human
- Omim: 605403 Human
- SwissProt: Q9Y2C9 Human
- Unigene: 575090 Human
-
Alternative names
- CD286 antibody
- CD286 antigen antibody
- TLR 6 antibody
see all
Images
-
Anti-TLR6 antibody [ABM1B50] (ab228424) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate
Predicted band size: 92 kDa -
Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling TLR6 with ab228424 at 0.5 µg/106 cells (red) compared with an isotype control of rabbit IgG (green). Goat anti-Mouse PE conjugate was used as secondary antibody.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab228424 has not yet been referenced specifically in any publications.