Anti-TLR6 antibody [ABM1B50] (ab228424)

Submit a review Submit a question
Western blot - Anti-TLR6 antibody [ABM1B50] (ab228424)
  • Flow Cytometry - Anti-TLR6 antibody [ABM1B50] (ab228424)

Key features and details

  • Mouse monoclonal [ABM1B50] to TLR6
  • Suitable for: Flow Cyt, WB
  • Reacts with: Human
  • Isotype: IgG1

Overview

  • Product name

    Anti-TLR6 antibody [ABM1B50]
    See all TLR6 primary antibodies

  • Description

    Mouse monoclonal [ABM1B50] to TLR6

  • Host species

    Mouse

  • Tested applications

    Suitable for: Flow Cyt, WBmore details

  • Species reactivity

    Reacts with: Human

  • Immunogen

    Recombinant fragment corresponding to Human TLR6 aa 280-512.
    Sequence:

    YLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFS EMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKL ETLILQKNGLKDLFKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVES IVVLNLSSNMLTDSVFRCLPPRIKVLDLHSNKIKSVPKQVVKLEALQELN VAFNSLTDLPGCGSFSSLSVL


    Database link: Q9Y2C9
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • WB: Jurkat whole cell lysate (ab7899). Flow Cyt: Jurkat cells.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab228424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5-1µg for 106 cells.
WB Use a concentration of 2 - 4 µg/ml. Predicted molecular weight: 92 kDa.

Target

  • Function

    Participates in the innate immune response to Gram-positive bacteria and fungi. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Recognizes mycoplasmal macrophage-activating lipopeptide-2kD (MALP-2), soluble tuberculosis factor (STF), phenol-soluble modulin (PSM) and B.burgdorferi outer surface protein A lipoprotein (OspA-L) cooperatively with TLR2.

  • Tissue specificity

    Detected in monocytes, CD11c+ immature dendritic cells, plasmacytoid pre-dendritic cells and dermal microvessel endothelial cells.

  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 12 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.

  • Cellular localization

    Cell membrane. Cytoplasmic vesicle > phagosome membrane.
  • Information by UniProt

  • Database links

    • Alternative names

      • CD286 antibody
      • CD286 antigen antibody
      • TLR 6 antibody
      • Tlr6 antibody
      • TLR6_HUMAN antibody
      • Toll like receptor 6 precursor antibody
      • Toll-like receptor 6 antibody
      see all

    Images

    • Western blot - Anti-TLR6 antibody [ABM1B50] (ab228424)
      Western blot - Anti-TLR6 antibody [ABM1B50] (ab228424)
      Anti-TLR6 antibody [ABM1B50] (ab228424) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

      Predicted band size: 92 kDa

    • Flow Cytometry - Anti-TLR6 antibody [ABM1B50] (ab228424)
      Flow Cytometry - Anti-TLR6 antibody [ABM1B50] (ab228424)

      Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cell line labeling TLR6 with ab228424 at 0.5 µg/106 cells (red) compared with an isotype control of rabbit IgG (green). Goat anti-Mouse PE conjugate was used as secondary antibody.

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    References (0)

    Publishing research using ab228424? Please let us know so that we can cite the reference in this datasheet.

    ab228424 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab228424.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com