Overview

  • Product name

  • Description

    Rabbit polyclonal to TLR8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human TLR8 aa 849-1041.
    Sequence:

    HHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVI NELRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTK KYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICK SSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY


    Database link: Q9NR97

  • Positive control

    • NCI-H460 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab180610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 120 kDa.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity

    Detected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 23 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 288 antibody
    • CD288 antibody
    • CD288 antigen antibody
    • MGC119599 antibody
    • MGC119600 antibody
    • TLR 8 antibody
    • Tlr8 antibody
    • TLR8_HUMAN antibody
    • Toll like receptor 8 antibody
    • Toll-like receptor 8 antibody
    see all

Images

  • Anti-TLR8 antibody (ab180610) at 1/500 dilution + NCI-H460 cell lysate

    Predicted band size: 120 kDa

References

This product has been referenced in:

  • Wang MX  et al. Acetyl-11-keto-ß-boswellic acid inhibits the secretion of cytokines by dendritic cells via the TLR7/8 pathway in an imiquimod-induced psoriasis mouse model and in vitro. Life Sci N/A:N/A (2018). WB ; Mouse . Read more (PubMed: 29859222) »
  • Meng Y  et al. Paeonol ameliorates imiquimod-induced psoriasis-like skin lesions in BALB/c mice by inhibiting the maturation and activation of dendritic cells. Int J Mol Med 39:1101-1110 (2017). Read more (PubMed: 28339016) »
See all 2 Publications for this product

Customer reviews and Q&As

1-5 of 5 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Cat Tissue sections (mesenteric lymph node)
Antigen retrieval step
None
Permeabilization
No
Specification
mesenteric lymph node
Blocking step
Dako blocking buffer as blocking agent for 10 minute(s) · Concentration: 100% · Temperature: 20°C
Fixative
Formaldehyde

Alexandra Malbon

Verified customer

Submitted Dec 07 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (Primary neurons)
Permeabilization
Yes - 0.1% Triton X-100/PBS
Specification
Primary neurons
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jul 19 2017

Application
Western blot
Sample
Cynomolgus Monkey Tissue lysate - whole (macaque retina)
Gel Running Conditions
Reduced Denaturing (4-15%)
Loading amount
200 µg
Specification
macaque retina
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Dec 06 2016

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Cynomolgus Monkey Tissue sections (macaque retina)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate pH 6
Permeabilization
No
Specification
macaque retina
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Formaldehyde

Abcam user community

Verified customer

Submitted Nov 11 2016

Application
Immunoprecipitation
Sample
Human Cell lysate - nuclear (HEK-hTLR8 overexpressing cells)
Immuno-precipitation step
Protein G
Specification
HEK-hTLR8 overexpressing cells

Miss. Lambrecht

Verified customer

Submitted Jul 21 2015

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up