Overview

  • Product name
  • Description
    Goat polyclonal to TLR8
  • Host species
    Goat
  • Tested applications
    Suitable for: WB, ICC, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide:

    CESFQGLQNLTKINLNHNPNVQHQNGNPGI

    , corresponding to amino acids 81-109 of Human TLR8

  • Positive control
    • Mouse spleen and human tonsil tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab53630 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 119 kDa.
ICC 1/400. Acetone fixed.
IHC-P Use at an assay dependent dilution.

Target

  • Function
    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity
    Detected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 23 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • CD 288 antibody
    • CD288 antibody
    • CD288 antigen antibody
    • MGC119599 antibody
    • MGC119600 antibody
    • TLR 8 antibody
    • Tlr8 antibody
    • TLR8_HUMAN antibody
    • Toll like receptor 8 antibody
    • Toll-like receptor 8 antibody
    see all

Images

  • ab53630 at 1/250 dilution staining TLR8 in mouse spleen by Immunohistochemistry, Paraffin embedded tissue.
  • ab53630 at 1/250 dilution staining TLR8 in human tonsil by Immunohistochemistry, Paraffin embedded tissue.

References

This product has been referenced in:
  • Wang Y  et al. Increased infiltration of CD11 c+/CD123+ dendritic cell subsets and upregulation of TLR/IFN-a signaling participate in pathogenesis of oral lichen planus. Oral Surg Oral Med Oral Pathol Oral Radiol 125:459-467.e2 (2018). IHC-P . Read more (PubMed: 29429903) »
  • Jiang C  et al. The Expression of Toll-like receptors in eutopic and ectopic endometrium and its implication in the inflammatory pathogenesis of adenomyosis. Sci Rep 7:7365 (2017). Read more (PubMed: 28779087) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab53630.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up