Overview

  • Product name

    Anti-TLR9 antibody [ABM4D70]
    See all TLR9 primary antibodies
  • Description

    Rat monoclonal [ABM4D70] to TLR9
  • Host species

    Rat
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Mouse TLR9 aa 602-860.
    Sequence:

    RFLDFSGNGMGRMWDEGGLYLHFFQGLSGLLKLDLSQNNLHILRPQNLDN LPKSLKLLSLRDNYLSFFNWTSLSFLPNLEVLDLAGNQLKALTNGTLPNG TLLQKLDVSSNSIVSVVPAFFALAVELKEVNLSHNILKTVDRSWFGPIVM NLTVLDVRSNPLHCACGAAFVDLLLEVQTKVPGLANGVKCGSPGQLQGRS IFAQDLRLCLDEVLSWDCFGLSLLAVAVGMVVPILHHLCGWDVWYCFHLC LAWLPLLAR


    Database link: Q9EQU3

  • Positive control

    • Mouse small intestine lysate; Mouse splenocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab210930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5µg for 106 cells.
WB Use a concentration of 2 µg/ml. Predicted molecular weight: 116 kDa.

Target

  • Function

    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity

    Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver.
  • Sequence similarities

    Belongs to the Toll-like receptor family.
    Contains 26 LRR (leucine-rich) repeats.
    Contains 1 TIR domain.
  • Cellular localization

    Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
  • Information by UniProt
  • Database links

  • Alternative names

    • CD 289 antibody
    • CD289 antibody
    • TLR 9 antibody
    • TLR9 antibody
    • TLR9_HUMAN antibody
    • Toll like receptor 9 antibody
    • Toll like receptor 9 isoform A precursor antibody
    • Toll like receptor 9 isoform B antibody
    • Toll-like receptor 9 antibody
    see all

Images

  • Anti-TLR9 antibody [ABM4D70] (ab210930) at 2 µg/ml + mouse small intestine lysate

    Predicted band size: 116 kDa

  • Flow cytometric analysis of mouse splenocytes labeling TLR9 with ab210930 at 0.5 µg/106 cells (red) compared with negative control cells (green). Goat anti-mouse PE conjugate was used as secondary antibody.

References

ab210930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab210930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up