Overview

  • Product name

    Anti-TM222 antibody
  • Description

    Rabbit polyclonal to TM222
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TM222 aa 77-164.
    Sequence:

    CTSTGVIRDFAGPYFVSEDNMAFGKPAKYWKLDPAQVYASGPNAWDTAVH DASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWN


    Database link: Q9H0R3

  • Positive control

    • WB: HepG2 whole cell lysate. IHC-P: Human heart and brain tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab236856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    The function of this protein has not been specifically defined.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • C1orf160 antibody
    • MGC111002 antibody
    • OTTHUMP00000004636 antibody
    • OTTHUMP00000004637 antibody
    • OTTHUMP00000197260 antibody
    • OTTMUSP00000011960 antibody
    • OTTMUSP00000037167 antibody
    • RGD1304793 antibody
    • Transmembrane protein 222 antibody
    see all

Images

  • MCF7 (human breast adenocarcinoma cell line) cells labeling TM222 (Green) using ab236856 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human heart tissue stained for TM222 using ab236856 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for TM222 using ab236856 at 1/100 dilution in immunohistochemical analysis.

  • Anti-TM222 antibody (ab236856) at 1/500 dilution + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

References

ab236856 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236856.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up