Overview

  • Product name

  • Description

    Rabbit polyclonal to TM9SF1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TM9SF1 aa 28-230.
    Sequence:

    PGVEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSL SLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELY YFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFA NVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGF FPR


    Database link: O15321

  • Positive control

    • IHC-P: Human prostate cancer and adrenal gland tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab235787 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

Images

  • Paraffin-embedded human prostate cancer tissue stained for TM9SF1 using ab235787 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for TM9SF1 using ab235787 at 1/100 dilution in immunohistochemical analysis.

References

ab235787 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235787.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up