Overview

  • Product name

    Anti-TMEM1 antibody - N-terminal
  • Description

    Rabbit polyclonal to TMEM1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TMEM1 aa 1-260 (N terminal).
    Sequence:

    MDASEEPLPPVIYTMENKPIVTCAGDQNLFTSVYPTLSQQLPREPMEWRR SYGRAPKMIHLESNFVQFKEELLPKEGNKALLTFPFLHIYWTECCDTEVY KATVKDDLTKWQNVLKAHSSVDWLIVIVENDAKKKNKTNILPRTSIVDKI RNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFTKNLGK FEDDMRTLREKRTEPGWSFCEYFMVQEELAFVFEMLQQFEDALVQYDELD ALFSQYVVNF


    Database link: P48553

  • Positive control

    • IHC-P: Human lung cancer and kidney tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224624 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1.
  • Cellular localization

    Golgi apparatus; integral to membrane.
  • Database links

  • Alternative names

    • EHOC 1 antibody
    • EHOC1 antibody
    • Epilepsy holoprosencephaly candidate 1 antibody
    • Epilepsy holoprosencephaly candidate 1 protein antibody
    • FLJ54223 antibody
    • FLJ54817 antibody
    • FLJ55683 antibody
    • GT 334 antibody
    • GT334 antibody
    • GT334 protein antibody
    • MGC126777 antibody
    • Protein GT334 antibody
    • TMEM 1 antibody
    • TMEM1 antibody
    • Trafficking protein particle complex 10 antibody
    • Trafficking protein particle complex subunit 10 antibody
    • Trafficking protein particle complex subunit 130 antibody
    • Trafficking protein particle complex subunit TMEM1 antibody
    • Transmembrane protein 1 antibody
    • Transport protein particle subunit TMEM1 antibody
    • TRAPP 130 kDa subunit antibody
    • TRAPP subunit TMEM1 antibody
    • TRS130 antibody
    • TRS30 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for TMEM1 using ab224624 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for TMEM1 using ab224624 at 1/100 dilution in immunohistochemical analysis.

References

ab224624 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224624.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up