Anti-TMEM117 antibody (ab243705)
Key features and details
- Rabbit polyclonal to TMEM117
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TMEM117 antibody -
Description
Rabbit polyclonal to TMEM117 -
Host species
Rabbit -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TMEM117 aa 434-507.
Sequence:MKRKSPSEHSKDMGITRENTQASVEDPLNDPSLVCIRSDFNEIVYKSSHL TSENLSSQLNESTSATEADQDPTT
Database link: Q9H0C3 -
Positive control
- ICC/IF: BJ cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
Target
-
Sequence similarities
Belongs to the TMEM117 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 84216 Human
- SwissProt: Q9H0C3 Human
- Unigene: 444668 Human
-
Alternative names
- B930062P21Rik antibody
- DKFZp434K2435 antibody
- RGD1562562 antibody
see all
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab243705 has not yet been referenced specifically in any publications.