Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM119
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TMEM119 aa 117-167.
    Sequence:

    ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEAL D


    Database link: Q4V9L6

  • Positive control

    • IHC-P: Human tonsil, lymph node, cerebral cortex and testis tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab185337 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use at an assay dependent concentration. PubMed: 27956744

Target

  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • OBIF antibody
    • Osteoblast induction factor antibody
    • PSEC0199 antibody
    • Transmembrane protein 119 antibody
    • UNQ731/PRO1415 antibody
    see all

Images

  • Paraffin-embedded human lymph node tissue stained for TMEM119 using ab185337 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human cerebral cortex tissue stained for TMEM119 using ab185337 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for TMEM119 using ab185337 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for TMEM119 using ab185337 at 1/50 dilution in immunohistochemical analysis.

    Negative control.

  • Ab185337 staining TMEM119 in human induced microglia by ICC/IF (Immunocytochemistry/Immunofluorescence). Cells were fixed with 4% paraformaldehyde for 15 minutes. Samples were incubated with primary antibody (1/200) for 2 hours at room temperature. Hoechst nuclear stain (blue) was used at 1/5000 dilution. 

  • Immunohistochemistry analysis of Human tonsil tissue labeling TMEM119 with ab185337 at 1/50 dilution.

References

This product has been referenced in:

  • Liu W  et al. Human Inner Ear Immune Activity: A Super-Resolution Immunohistochemistry Study. Front Neurol 10:728 (2019). Read more (PubMed: 31354608) »
  • Sellgren CM  et al. Patient-specific models of microglia-mediated engulfment of synapses and neural progenitors. Mol Psychiatry 22:170-177 (2017). ICC/IF ; Human . Read more (PubMed: 27956744) »
See all 3 Publications for this product

Customer reviews and Q&As

1-10 of 12 Abreviews or Q&A

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Testis, adult)
Permeabilization
Yes - 0.1% Triton X-100 in PBS
Specification
Testis, adult
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: 20°C
Fixative
Paraformaldehyde

Mr. Bryan Niedenberger

Verified customer

Submitted Jul 23 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (spinal cord tumour (Ependymoma))
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: sodium citrate pH 6.0
Permeabilization
Yes - PBS-T+Triton-X-100
Specification
spinal cord tumour (Ependymoma)
Blocking step
(agent) for 1 hour(s) and 0 minute(s) · Concentration: 100% · Temperature: 25°C
Fixative
Formaldehyde

Mr. Omar Ahmad

Verified customer

Submitted May 22 2019

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Microglia)
Permeabilization
Yes - 0.3% Triton X-100
Specification
Microglia
Blocking step
FBS as blocking agent for 16 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Apr 08 2019

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (BRAIN)
Antigen retrieval step
Enzymatic - Buffer/Enzyme Used: PROTEASA k
Specification
BRAIN
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 37°C
Fixative
Paraformaldehyde

Miss. Paula Sanchis

Verified customer

Submitted Jan 10 2019

Application
Immunohistochemistry (Frozen sections)
Sample
Rat Tissue sections (brain)
Permeabilization
No
Specification
brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 2% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Nov 19 2018

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Spinal cord)
Permeabilization
Yes - 0,3% triton
Specification
Spinal cord
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Dec 05 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (brain tissue - Hippocampus)
Permeabilization
Yes - 0.3% Triton-100 in PBS
Specification
brain tissue - Hippocampus
Blocking step
Serum as blocking agent for 20 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde

Dr. Ying Jiang

Verified customer

Submitted Jun 30 2017

Application
Immunohistochemistry free floating
Sample
Rat Tissue sections (Brain)
Specification
Brain

Abcam user community

Verified customer

Submitted May 18 2017

Application
Immunohistochemistry free floating
Sample
Pig Tissue sections (brain)
Specification
brain

Audrey Lafrenaye

Verified customer

Submitted Jan 24 2017

Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Rat Tissue sections (Brain)
Antigen retrieval step
None
Permeabilization
Yes - Triton X-100 included in blocking step
Specification
Brain
Blocking step
10% Donkey Serum 3% BSA 0.3% Triton X-100 as blocking agent for 2 hour(s) and 0 minute(s) · Temperature: 22°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Sep 14 2016

1-10 of 12 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up