Anti-TMEM119 antibody - C-terminal (ab185333)
Key features and details
- Rabbit polyclonal to TMEM119 - C-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TMEM119 antibody - C-terminal
See all TMEM119 primary antibodies -
Description
Rabbit polyclonal to TMEM119 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TMEM119 aa 194-282 (C terminal).
Sequence:GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGA VVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Database link: Q4V9L6 -
General notes
This antibody is suitable for detecting human TMEM119 by IHC. To detect mouse TMEM119 by IHC, we recommend using ab209064.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Immunizing Peptide (Blocking)
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab185333 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Cellular localization
Membrane; Single-pass type I membrane protein -
Database links
- Entrez Gene: 338773 Human
- SwissProt: Q4V9L6 Human
- Unigene: 449718 Human
-
Alternative names
- OBIF antibody
- Osteoblast induction factor antibody
- PSEC0199 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lymph node tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
Protocols
References (7)
ab185333 has been referenced in 7 publications.
- Niu F et al. Cocaine-induced release of CXCL10 from pericytes regulates monocyte transmigration into the CNS. J Cell Biol 218:700-721 (2019). PubMed: 30626719
- Hasselmann J et al. Development of a Chimeric Model to Study and Manipulate Human Microglia In Vivo. Neuron 103:1016-1033.e10 (2019). PubMed: 31375314
- Xie J et al. Olfactory Ensheathing Cells Grafted Into the Retina of RCS Rats Suppress Inflammation by Down-Regulating the JAK/STAT Pathway. Front Cell Neurosci 13:341 (2019). PubMed: 31402855
- Yuan J et al. Single-cell transcriptome analysis of lineage diversity in high-grade glioma. Genome Med 10:57 (2018). PubMed: 30041684
- Zheng P et al. TMEM119 silencing inhibits cell viability and causes the apoptosis of gastric cancer SGC-7901 cells. Oncol Lett 15:8281-8286 (2018). PubMed: 30112075
- Abud EM et al. iPSC-Derived Human Microglia-like Cells to Study Neurological Diseases. Neuron 94:278-293.e9 (2017). PubMed: 28426964
- Bennett ML et al. New tools for studying microglia in the mouse and human CNS. Proc Natl Acad Sci U S A 113:E1738-46 (2016). ICC/IF ; Human . PubMed: 26884166
