Anti-TMEM119 antibody - C-terminal (ab185333)
- Datasheet
- References (6)
- Protocols
Overview
-
Product name
Anti-TMEM119 antibody - C-terminal
See all TMEM119 primary antibodies -
Description
Rabbit polyclonal to TMEM119 - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IHC-Frmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TMEM119 aa 194-282 (C terminal).
Sequence:GDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGA VVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPS
Database link: Q4V9L6 -
Positive control
- IHC-P: Human cerebral cortex, lymph node and testis tissues.
-
General notes
This antibody is suitable for detecting human TMEM119 by IHC. To detect mouse TMEM119 by IHC, we recommend using ab209064.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG
Associated products
-
Compatible Secondaries
-
Immunizing Peptide (Blocking)
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab185333 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. | |
| IHC-Fr | Use at an assay dependent concentration. PubMed: 26884166 |
Target
-
Cellular localization
Membrane; Single-pass type I membrane protein -
Database links
- Entrez Gene: 338773 Human
- SwissProt: Q4V9L6 Human
- Unigene: 449718 Human
-
Alternative names
- OBIF antibody
- Osteoblast induction factor antibody
- PSEC0199 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human cerebral cortex tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human liver tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lymph node tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human testis tissue labelling TMEM119 with ab185333 at a dilution of 1/1000.
-
Immunohistochemistry (Frozen sections) - Anti-TMEM119 antibody - C-terminal (ab185333)Image from Bennett ML et al. Proc Natl Acad Sci, Issue 113(12) , Fig 6b, DOI: 10.1073/pnas.1525528113Ab185333 staining TMEM119 in Human Brain tissue (acute surgical samples & post-mortem) sections by Immunohistochemistry (IHC-Fr-Frozen sections). Tissue was fixed with formaldehyde and permeabilized with 0.3-0.5% Triton X in PBS and blocked with 10% Serum for 1 hours at 23°C. Samples were incubated with primary antibody at (1:100 dilution in 1% serum in PBS-Triton X) for 16 hours at 4°C. An Alexa Fluor® 488 Goat anti-rabbit (4µg/ml) was used as the secondary antibody.
References
This product has been referenced in:
- Niu F et al. Cocaine-induced release of CXCL10 from pericytes regulates monocyte transmigration into the CNS. J Cell Biol 218:700-721 (2019). Read more (PubMed: 30626719) »
- Hasselmann J et al. Development of a Chimeric Model to Study and Manipulate Human Microglia In Vivo. Neuron 103:1016-1033.e10 (2019). Read more (PubMed: 31375314) »
