Overview

  • Product name

    Anti-TMEM122 antibody
  • Description

    Rabbit polyclonal to TMEM122
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TMEM122 aa 24-89.
    Sequence:

    ISCSLDWLMVSVIPVAESRNLYIFADELHLGMGCPANRIHTYVYEFIYLV RDCGIRTRVVSEETLL


    Database link: Q86WS3

  • General notes

    Previously labelled as PLAC1L.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of Paraffin-embedded Human liver cancer tissue labeling TMEM122 with ab187749 at 1/200 dilution.

  • Immunohistochemical analysis of Paraffin-embedded Human placenta tissue labeling TMEM122 with ab187749 at 1/200 dilution.

  • Immunohistochemical analysis of Paraffin-embedded Human small intestine tissue labeling TMEM122 with ab187749 at 1/200 dilution.

References

ab187749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up