Overview

  • Product name

    Anti-TMEM132D antibody
  • Description

    Rabbit polyclonal to TMEM132D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 700-749(

    QRPKQEAAISCWVQFSDGSVTPLDIYDEKDFSLMATSLDEKVVSILQDPK

    ) of Mouse TMEM132D (NP_766473).

  • Positive control

    • Mouse liver lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab116041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 122 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-TMEM132D antibody (ab116041) at 1 µg/ml + mouse liver lysate at 10 µg

    Predicted band size: 122 kDa



    Gel concentration 6-18%

References

ab116041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Question
Answer

Thank you for taking the time to complete our questionnaire and contact us. I am sorry to hear you have had difficulty obtaining satisfactory results from this antibody.
The details you have kindly provided will enable us to investigate this case for you and also gives us vital information for our monitoring of product quality
I appreciate the time you have spent in the laboratory and understand your concerns. It is regrettable the results have not been successful. I would like to reassure you that this antibody is tested and covered by our guarantee for WB and mice.
Before deciding how to proceed with this particular case, I would like to offer some suggestions to help optimise the results. I would also appreciate if you can confirm some details of the procedure.
1. Could you please confirm how the knock out was achieved. In human we found an isoform 2 of the TMEM132D with a molecuar weight of 70 kDa. Furthermore in the WB image on our datasheet this 70 kDa band is detected in mouse liver lysate.
2. Could you confirm whether it was tested if the knock out is achieved for both isoforms? For example has this been tested with RT-PCR?
3. It would be beneficial to run a positive control of mouse liver lysate for this experiment if not already done. That would show if the antibody does not detect the 122 kDa protein in a tested sample.
4. If possible the amount of loaded protein should be between 20-30 ug. If the protein is expressed at a low level this amount of protein might be crucial for the detection. Because the used antibody is polyclonal the affinity against the protein can be vary for different lots. This is due to different immunisation rounds and hosts.
5. We would suggest it might be beneficial to reduce the dilution of primary antibody for the detection. We recommend a 1/500 dilution for WB with antibodies out of whole antiserum.
We are happy to offer this technical support. In the event that a product is not functioning in the tested applications and species cited on the product data sheet (and the problem has been reported within 6 months of purchase), we will be pleased to provide a credit note, free of charge replacement or refund.
I hope this information is helpful, thank you for your cooperation. Should the suggestions not improve the results, please do not hesitate to contact me again with the further requested details.

Read More
Application
Western blot
Sample
Rat Cell lysate - whole cell (INS1 cells)
Loading amount
30000 cells
Specification
INS1 cells
Gel Running Conditions
Reduced Denaturing (8 %)
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Dr. Olatz Villate

Verified customer

Submitted Mar 15 2012

Answer

Thank you for contacting us.
Ab116041 has never been tested in rat. It doesn’t mean it won’t work in this species, but we don’t have data to support it. I performed a BLAST to evaluate the percentage of homology with rat species, and it’s very likely this antibody will recognise the protein in rat.
If you are interested in participating in our antibodies evaluation system (Abreview), and test ab116041 with rat samples (by WB) I will be happy to offer a discount code for a future purchase if you submit the results (in a form of an Abreview) to our website.
Therefore, I can offer a discount off a future purchase if you buy the antibody and test it in rat species and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free primary antibody.

If you are interested in this offer, please follow these steps:
1. Reply to this e-mail to let me know that you would like to proceed and test ab116041 with rat lysates. I will then send a discount code. This code must be issued before purchasing the antibody so please wait for my reply before ordering.
2. Purchase the antibody either by phone, fax, or online (www.abcam.com).
3. Test it in WB with rat samples.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!).

To find out more about our Abreview system, please visit: https://www.abcam.com/abreviews.
5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any primary antibody ordered and the discount code is valid for 4 months after issue.
Please let me know if you have any questions about this offer and I would be happy to help you further.
The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up