Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM158
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Cow, Human
  • Immunogen

    Synthetic peptide within Human TMEM158 aa 200-250 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LDFSLEELQGEPGWRLNRKPIESTLVACFMTLVIVVWSVAALIWPVPIIA G


    Database link: Q8WZ71

  • Positive control

    • Rat brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab213691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

When using a fluorescent probe the recommended dilution is 1/50 – 1/200.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling TMEM158 with ab213691 at 1/200 dilution, ollowed by a conjugated secondary and DAPI staining. Antigen retrieval method used boiling in sodium citrate buffer.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling TMEM158 with ab213691 at 1/200 dilution, followed by a conjugated secondary and DAB staining. Antigen retrieval method used boiling in sodium citrate buffer.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Rat brain tissue labeling TMEM158 with ab213691 at 1/200 dilution, followed by a conjugated secondary and DAB staining. 

References

ab213691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up