Recombinant

Recombinant Anti-TMEM16A antibody [DG1/1487R] - BSA and Azide free (ab218942)

Overview

  • Product name

    Anti-TMEM16A antibody [DG1/1487R] - BSA and Azide free
    See all TMEM16A primary antibodies
  • Description

    Rabbit monoclonal [DG1/1487R] to TMEM16A - BSA and Azide free
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMEM16A aa 1-986.
    Sequence:

    MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECK YGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP LPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKI HGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQK ITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIV YEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARA SHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAV KDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK LTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAM NSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAP LFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVII NAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPN DPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWME KERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL


    Database link: Q5XXA6

  • Positive control

    • IHC-P; Human Gastrointestinal Stromal Tumor (GIST) tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein A/G purified
  • Clonality

    Monoclonal
  • Clone number

    DG1/1487R
  • Isotype

    IgG
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab218942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 0.25 - 0.5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a calcium-activated chloride channel. Required for normal tracheal development.
  • Tissue specificity

    Broadly expressed with higher levels in liver and skeletal muscle.
  • Sequence similarities

    Belongs to the anoctamin family.
  • Domain

    The region spanning the fifth and sixth transmembrane domains probably forms the pore-forming region.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANO 1 antibody
    • ANO1 antibody
    • ANO1_HUMAN antibody
    • Anoctamin 1 antibody
    • Anoctamin 1 calcium activated chloride channel antibody
    • Anoctamin-1 antibody
    • Anoctamin1 antibody
    • Ca2+ activated Cl- channel antibody
    • Calcium Activated Chloride Channel antibody
    • Discovered on gastrointestinal stromal tumors protein 1 antibody
    • DOG 1 antibody
    • DOG1 antibody
    • FLJ10261 antibody
    • Membrane protein antibody
    • Oral cancer overexpressed 2 antibody
    • Oral cancer overexpressed protein 2 antibody
    • ORAOV 2 antibody
    • ORAOV2 antibody
    • TAOS 2 antibody
    • TAOS2 antibody
    • TMEM 16A antibody
    • TMEM16A antibody
    • Transmembrane protein 16A (eight membrane spanning domains) antibody
    • Transmembrane protein 16A antibody
    • Tumor amplified and overexpressed sequence 2 antibody
    • Tumor-amplified and overexpressed sequence 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human Gastrointestinal Stromal Tumor (GIST) tissue labeling TMEM16A with ab218942 at 0.5 µg/ml for 30 minutes at RT.

References

ab218942 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218942.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up