Overview

  • Product name

    Anti-TMEM16A antibody [DG1/447 + DOG-1.1]
    See all TMEM16A primary antibodies
  • Description

    Mouse monoclonal [DG1/447 + DOG-1.1] to TMEM16A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IP, IHC-Fr, ICC/IF, Flow Cyt, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    This product was produced with the following immunogens:
    Synthetic peptide corresponding to Human TMEM16A aa 904-986 (C terminal). Immunogen used to raise the antibody in DOG-1.1. conjugated to a carrier protein.
    Sequence:

    MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER QKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL


    Database link: Q5XXA6

    Recombinant full length protein corresponding to Human TMEM16A aa 1-986. Immunogen used to raise the antibody in DG1/447.
    Sequence: MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECK YGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP LPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKI HGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQK ITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIV YEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARA SHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAV KDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK LTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAM NSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAP LFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVII NAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPN DPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWME KERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL
    Database link: Q5XXA6

  • Positive control

    • Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
  • General notes

    Please note that this antibody is an oligoclonal antibody. It is a cocktail of monoclonal antibodies that have been carefully selected. Oligoclonal antibodies have not only the specificity and batch-to-batch consistency of a monoclonal antibody, but also have the advantage of the sensitivity of a polyclonal antibody due to their ability to recognize multiple epitopes on an antigen. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 99% PBS, 0.05% BSA
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    DG1/447 + DOG-1.1
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab200486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 114 kDa.
IP Use at 1-2 µg/mg of lysate.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.
ICC/IF Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Acts as a calcium-activated chloride channel. Required for normal tracheal development.
  • Tissue specificity

    Broadly expressed with higher levels in liver and skeletal muscle.
  • Sequence similarities

    Belongs to the anoctamin family.
  • Domain

    The region spanning the fifth and sixth transmembrane domains probably forms the pore-forming region.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANO 1 antibody
    • ANO1 antibody
    • ANO1_HUMAN antibody
    • Anoctamin 1 antibody
    • Anoctamin 1 calcium activated chloride channel antibody
    • Anoctamin-1 antibody
    • Anoctamin1 antibody
    • Ca2+ activated Cl- channel antibody
    • Calcium Activated Chloride Channel antibody
    • Discovered on gastrointestinal stromal tumors protein 1 antibody
    • DOG 1 antibody
    • DOG1 antibody
    • FLJ10261 antibody
    • Membrane protein antibody
    • Oral cancer overexpressed 2 antibody
    • Oral cancer overexpressed protein 2 antibody
    • ORAOV 2 antibody
    • ORAOV2 antibody
    • TAOS 2 antibody
    • TAOS2 antibody
    • TMEM 16A antibody
    • TMEM16A antibody
    • Transmembrane protein 16A (eight membrane spanning domains) antibody
    • Transmembrane protein 16A antibody
    • Tumor amplified and overexpressed sequence 2 antibody
    • Tumor-amplified and overexpressed sequence 2 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human gastrointestinal stromal tumor tissue, labeling TMEM16A using ab200486 at 1 μg/ml. Zoom 20X.

References

ab200486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up