Overview

  • Product name

    Anti-TMEM16A antibody [DG1/447]
    See all TMEM16A primary antibodies
  • Description

    Mouse monoclonal [DG1/447] to TMEM16A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IF, IP, IHC-Frmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMEM16A aa 1-986.
    Sequence:

    MRVNEKYSTLPAEDRSVHIINICAIEDIGYLPSEGTLLNSLSVDPDAECK YGLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHP LPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELERDEDTKI HGVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQK ITDPIQPKVAEHRPQTMKRLSYPFSREKQHLFDLSDKDSFFDSKTRSTIV YEILKRTTCTKAKYSMGITSLLANGVYAAAYPLHDGDYNGENVEFNDRKL LYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGI IVFLYGCATMDENIPSMEMCDQRHNITMCPLCDKTCSYWKMSSACATARA SHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAV KDHPRAEYEARVLEKSLKKESRNKEKRRHIPEESTNKWKQRVKTAMAGVK LTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAM NSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEK SFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSP PDHEECVKRKQRYEVDYNLEPFAGLTPEYMEMIIQFGFVTLFVASFPLAP LFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVII NAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPN DPLDLGYEVQICRYKDYREPPWSENKYDISKDFWAVLAARLAFVIVFQNL VMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWME KERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL


    Database link: Q5XXA6

  • Positive control

    • Human gastrointestinal stromal tumor and testicular germ cell tumor tissues; Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    DG1447
  • Isotype

    IgG1
  • Light chain type

    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 1 µg/ml. Predicted molecular weight: 114 kDa.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt Use 0.5-1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
IP Use at 1-2 µg/mg of lysate.
IHC-Fr Use a concentration of 0.5 - 1 µg/ml.

Target

  • Function

    Acts as a calcium-activated chloride channel. Required for normal tracheal development.
  • Tissue specificity

    Broadly expressed with higher levels in liver and skeletal muscle.
  • Sequence similarities

    Belongs to the anoctamin family.
  • Domain

    The region spanning the fifth and sixth transmembrane domains probably forms the pore-forming region.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANO 1 antibody
    • ANO1 antibody
    • ANO1_HUMAN antibody
    • Anoctamin 1 antibody
    • Anoctamin 1 calcium activated chloride channel antibody
    • Anoctamin-1 antibody
    • Anoctamin1 antibody
    • Ca2+ activated Cl- channel antibody
    • Calcium Activated Chloride Channel antibody
    • Discovered on gastrointestinal stromal tumors protein 1 antibody
    • DOG 1 antibody
    • DOG1 antibody
    • FLJ10261 antibody
    • Membrane protein antibody
    • Oral cancer overexpressed 2 antibody
    • Oral cancer overexpressed protein 2 antibody
    • ORAOV 2 antibody
    • ORAOV2 antibody
    • TAOS 2 antibody
    • TAOS2 antibody
    • TMEM 16A antibody
    • TMEM16A antibody
    • Transmembrane protein 16A (eight membrane spanning domains) antibody
    • Transmembrane protein 16A antibody
    • Tumor amplified and overexpressed sequence 2 antibody
    • Tumor-amplified and overexpressed sequence 2 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastrointestinal stromal tumor tissue labeling TMEM16A with ab190721 at 1 µg/ml.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human gastrointestinal stromal tumor tissue labeling TMEM16A with ab190721 at 1 µg/ml.

References

This product has been referenced in:

  • Chai RR  et al. Prohibitin involvement in the generation of mitochondrial superoxide at complex I in human sperm. J Cell Mol Med 21:121-129 (2017). Read more (PubMed: 27558591) »
  • Klaka P  et al. A novel organotypic 3D sweat gland model with physiological functionality. PLoS One 12:e0182752 (2017). Read more (PubMed: 28796813) »
See all 2 Publications for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Mouse Tissue sections (small intestine)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: citrate pH6
Permeabilization
No
Specification
small intestine
Blocking step
DAKO as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 100%
Fixative
Paraformaldehyde

Steven Nilsen

Verified customer

Submitted Feb 15 2019

Application
Immunohistochemistry (Frozen sections)
Sample
Rabbit Tissue sections (colon)
Permeabilization
Yes - 0.3% TX-100 in PBS
Specification
colon
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 23°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Nov 17 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up