Overview

  • Product name

    Anti-TMEM170A antibody
  • Description

    Rabbit polyclonal to TMEM170A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TMEM170A aa 16-46.
    Sequence:

    LQQILSLKVVPRVGNGTLCPNSTSLCSFPEM


    Database link: Q8WVE7

  • Positive control

    • Human liver and liver cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human liver tissue labeling TMEM170A with ab188151 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver tissue labeling TMEM170A with ab188151 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling TMEM170A with ab188151 at 1/50 dilution.

References

ab188151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up