Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM175
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human TMEM175 aa 36-85 (N terminal).
    Sequence:

    MLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRLLATRIAVYLMTF

  • Positive control

    • HepG2 cell lysate
  • General notes

    Previously labelled as MGC4618. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab49189 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 56 kDa (predicted molecular weight: 56 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:1562500.

Target

Images

  • Anti-TMEM175 antibody (ab49189) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Developed using the ECL technique.

    Predicted band size: 56 kDa
    Observed band size: 56 kDa



    Diluted in 5% skim milk / PBS buffer, gel concentration 12%

References

ab49189 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Western blot
Sample
Zebrafish Tissue lysate - whole (Adult brain)
Gel Running Conditions
Reduced Denaturing (4-15% BioRad Precast)
Loading amount
20 µg
Specification
Adult brain
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Abcam user community

Verified customer

Submitted Sep 19 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up