Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM177
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TMEM177 aa 219-311.
    Sequence:

    SQDSLTHAVESWLDRRTASLSAAYACGGVEFYEKLLSGNLALRSLLGKDG EKLYTPSGNIVPRHLFRIKHLPYTTRRDSVLQMWRGMLNPGRS


    Database link: Q53S58

  • Positive control

    • WB: COLO 205 and K562 cell lysate. IHC-P: Human liver cancer and colon cancer tissue. ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 34 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-TMEM177 antibody (ab237815) at 1/500 dilution + COLO 205 (Human colon adenocarcinoma cell line) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 34 kDa

  • Paraffin-embedded human liver cancer tissue stained for TMEM177 using ab237815 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon cancer tissue stained for TMEM177 using ab237815 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for TMEM177 (green) using ab237815 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

  • Anti-TMEM177 antibody (ab237815) at 1/500 dilution + K562 (human chronic myelogenous leukemia cell line from bone marrow ) cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 34 kDa

References

ab237815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up