Anti-TMEM182 antibody - N-terminal (ab177360)

Overview

  • Product name
    Anti-TMEM182 antibody - N-terminal
  • Description
    Rabbit polyclonal to TMEM182 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human TMEM182 aa 67-116 (N terminal). The exact sequence is proprietary. NP_653233
    Sequence:

    ENDSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAVIYRGFW


    Database link: Q6ZP80

  • Positive control
    • Human fetal liver lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa.

Target

Images

  • Anti-TMEM182 antibody - N-terminal (ab177360) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Predicted band size: 23 kDa



    5% milk block used

References

ab177360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abcam has not validated the combination of species/application used in this Abreview.
Application
Western blot
Sample
Mouse Tissue lysate - whole (Skeletal Muscle)
Gel Running Conditions
Reduced Denaturing (10% polyacrylamide)
Loading amount
50 µg
Specification
Skeletal Muscle
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Jul 19 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up