Overview

  • Product name

    Anti-TMEM186 antibody
  • Description

    Rabbit polyclonal to TMEM186
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human TMEM186 aa 124-213.
    Sequence:

    LRRLVGILYLNESGTMLRVAHLNFWGWRQDTYCPMADVIPLTETKDRPQE MFVRIQRYSGKQTFYVTLRYGRILDRERFTQVFGVHQMLK


    Database link: Q96B77

  • Positive control

    • WB: Mouse brain tissue lysate. IHC-P: Human testis and kidney tissue. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

Images

  • Anti-TMEM186 antibody (ab236849) at 1/500 dilution + Mouse brain tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution
  • MCF7 (Human breast adenocarcinoma cell line) cells stained for TMEM186 (Green) using ab236849 at a 1/100 dilution in ICC/IF, followed by Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

  • Paraffin-embedded human kidney tissue stained for TMEM186 with ab236849 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for TMEM186 with ab236849 at a 1/100 dilution in immunohistochemical analysis.

References

ab236849 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up