Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM192
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IP, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TMEM192 aa 193-271.
    Sequence:

    KIRRFNKAKPEPDILEEEKIYAYPSNITSETGFRTISSLEEIVEKQGDTI EYLKRHNALLSKRLLALTSSDLGCQPSRT


    Database link: Q8IY95

  • Positive control

    • WB: HeLa whole cell lysate. IHC-P: Human adrenal gland and glioma tissues. ICC/IF: A549 cells. IP: Jurkat whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 31 kDa.
IP 1/200 - 1/2000.
ICC/IF 1/50 - 1/500.

Target

Images

  • Anti-TMEM192 antibody (ab236858) at 1/1000 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 31 kDa

  • Paraffin-embedded human adrenal gland tissue stained for TMEM192 using ab236858 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human glioma tissue stained for TMEM192 using ab236858 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • A549 (human lung carcinoma cell line) cells stained for TMEM192 (green) using ab236858 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C

  • TMEM192 was immunoprecipitated from 0.5 mg Jurkat (human T cell leukemia cell line from peripheral blood) whole cell extract with ab236858 at 1/200 dilution. 

    Lane 1: Control rabbit IgG IP in Jurkat whole cell lysate.

    Lane 2: ab236858 IP in Jurkat whole cell lysate.

    Lane 3: Jurkat whole cell lysate 10 μg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up