Anti-TMEM208 antibody (ab130459)
Key features and details
- Rabbit polyclonal to TMEM208
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TMEM208 antibody
See all TMEM208 primary antibodies -
Description
Rabbit polyclonal to TMEM208 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment: PWFTADSGTPAPEHNEKRQRRQERRQMKRL, corresponding to amino acids 144-173 of Human TMEM208 Isoform 1 (Q9BTX3).
-
Positive control
- Human rectum tissue.
-
General notes
The antibody solution should be gently mixed before use. ab139459 is a mono-specific antibody. Working dilution samples should be discarded if not used within 12 hours.The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab130459 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 0.04 - 0.4 µg/ml.
|
|
ICC/IF |
Use a concentration of 1 - 4 µg/ml.
Recommend PFA Fixation and Triton X-100 treatment |
|
IHC-P |
1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
Use a concentration of 0.04 - 0.4 µg/ml. |
ICC/IF
Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
IHC-P
1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Sequence similarities
Belongs to the TMEM208 family. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 29100 Human
- SwissProt: Q9BTX3 Human
- Unigene: 433203 Human
-
Alternative names
- HSPC171 antibody
- TM208_HUMAN antibody
- tmem208 antibody
- Transmembrane protein 208 antibody
Images
-
Lane 1: Marker [kDa] 250; 130; 95; 72; 55; 36; 28; 17; 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cell. -
Immunofluorescent staining of Human cell line A-431 shows positivity in cytoplasm. Recommended concentration of ab130459 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM208 antibody (ab130459)ab130459, at 1/20 dilution, staining TMEM208 in paraffin-embedded Human rectum tissue by Immunohistochemistry
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab130459 has not yet been referenced specifically in any publications.