Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM24
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IP, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla
  • Immunogen

    Synthetic peptide within Human TMEM24 aa 656-706. The exact sequence is proprietary.
    Sequence:

    EAGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQ L


    Database link: O14523

  • Positive control

    • HeLa, 293T, Jurkat, mouse TCMK1, and mouse NIH 3T3 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at 2-10 µg/mg of lysate.
WB 1/2000 - 1/10000. Predicted molecular weight: 76 kDa.

Target

Images

  • Detection of TMEM24 in Immunoprecipitates of Jurkat whole cell lysates (1 mg for IP, 20% of IP loaded) using ab205949 at 6 µg/mg lysate for IP and 0.4µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 30 seconds.

  • All lanes : Anti-TMEM24 antibody (ab205949) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK1 whole cell lysate
    Lane 5 : NIH 3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 76 kDa


    Exposure time: 30 seconds

References

ab205949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up