For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    By product type
    Proteins and Peptides
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Lysates
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    • Protocols & troubleshooting
    • Technical FAQs
    • Get technical help
    • RabMAb Advantages
    • Buying FAQs
    • Antibody Guide
    • Scientific webinars
    • Biochemical product FAQ
    • Support resources
    • eProcurement
    Check out our protocols

    Visit protocols and troubleshooting or check them out using the Abcam app for iPhone

    Protocols and troubleshooting

    iPhone app

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    tmem240-antibody-ab227876.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Share by email

Anti-TMEM240 antibody (ab227876)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

  • Immunocytochemistry/ Immunofluorescence - Anti-TMEM240 antibody (ab227876)

Add compatible products

Primary

Product image

 

Secondary

Product image

 

Unfortunately, one or more of the products below are unavailable in your country/region.

Sorry, we can't display this right now.
Please contact us to place your order, or try again later.

View more associated products

  • Datasheet
  • References
  • Protocols

Overview

  • Product name

    Anti-TMEM240 antibody
  • Description

    Rabbit polyclonal to TMEM240
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human TMEM240 aa 42-87.
    Sequence:

    LRGEDRVCHCNCGRHHIHYVIPYDGDQSVVDASENYFVTDSVTKQE


    Database link: Q5SV17

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

Applications

Our Abpromise guarantee covers the use of ab227876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/20 - 1/200.

Target

  • Involvement in disease

    Spinocerebellar ataxia 21
  • Sequence similarities

    Belongs to the TMEM240 family.
  • Cellular localization

    Cell junction, synapse. Cell membrane.
  • Target information above from: UniProt accession Q5SV17 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 339453 Human
    • SwissProt: Q5SV17 Human
    • Unigene: 668654 Human
    • Alternative names

      • TM240_HUMAN antibody
      • TMEM240 antibody
      • Transmembrane protein 240 antibody

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-TMEM240 antibody (ab227876)
      Immunocytochemistry/ Immunofluorescence - Anti-TMEM240 antibody (ab227876)

      HepG2 (human liver hepatocellular carcinoma cell line) cells stained for TMEM240 (green) using ab227876 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

    Datasheets and documents

    • Datasheet
    • SDS
  • References

    ab227876 has not yet been referenced specifically in any publications.

    Publishing research using ab227876? Please let us know so that we can cite the reference in this datasheet.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab227876.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & advice
    • Buying FAQs
    • RabMAb products
    • Biochemical product FAQs
    Company
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2019 Abcam plc. All rights reserved.