Anti-Tmem27 antibody (ab233531)
Key features and details
- Rabbit polyclonal to Tmem27
- Suitable for: WB, IHC-P
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-Tmem27 antibody
See all Tmem27 primary antibodies -
Description
Rabbit polyclonal to Tmem27 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse -
Immunogen
Recombinant fragment (His-T7-tag) corresponding to Rat Tmem27 aa 15-141. Two N-terminal tags. Expressed in E.coli.
Sequence:ELCRPDAENAFKVRLSIKAALGDKAYVWDTDEEYLFRAMVAFSMRKVPNR EGTEISHVLLCNVTQRVSFWFVVTDPLKNHTLPAAEVQSAIRMNRNRINS AFFLDDHTLEFLKIPSTLAPPMDPSVP
Database link: Q9ESG3 -
Positive control
- WB: Recombinant rat Tmem27protein; Rat serum. IHC-P: Rat kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab233531 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 25 kDa. | |
IHC-P | Use a concentration of 5 - 20 µg/ml. |
Target
-
Function
Regulator of SNARE complex function. Stimulator of beta cell replication. -
Tissue specificity
Kidney; collecting ducts. Pancreas; beta cells of islets. -
Sequence similarities
Belongs to the TMEM27 family. -
Post-translational
modificationsGlycosylated.
The extracellular domain is cleaved and released from the cell membrane of pancreatic beta cells. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 57394 Mouse
- Entrez Gene: 57395 Rat
- SwissProt: Q9ESG4 Mouse
- SwissProt: Q9ESG3 Rat
- Unigene: 143766 Mouse
- Unigene: 32298 Rat
-
Alternative names
- UNQ679 antibody
- Collectrin antibody
- kidney-specific membrane protein antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Tmem27 antibody (ab233531)
Formalin-fixed, paraffin-embedded rat kidney tissue stained for Tmem27 using ab233531 at 20μg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Tmem27 antibody (ab233531) at 2 µg/ml + Recombinant rat Tmem27 protein
Developed using the ECL technique.
Predicted band size: 25 kDa -
Anti-Tmem27 antibody (ab233531) at 2 µg/ml + Rat serum
Developed using the ECL technique.
Predicted band size: 25 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab233531 has not yet been referenced specifically in any publications.