Overview

  • Product name

    Anti-Tmem27 antibody [C7]
    See all Tmem27 primary antibodies
  • Description

    Mouse monoclonal [C7] to Tmem27
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Mouse Tmem27 aa 12-222. Two N-terminal Tags, His-tag and GST-tag (Expressed in E.coli).
    Sequence:

    IHAELCHPDAENAFKVRLSIRAALGDKAYVWDTDQEYLFRAMVAFSMRKV PNREATEISHVLLCNITQRVSFWFVVTDPSNNYTLPAAEVQSAIRKNRNR INSAFFLDDHTLEFLKIPSTLAPPMEPSVPVWIIVFGVIFCIVTVAIALL VLSGIRQRRRNNKGPPGVEDAEDKCENIITIENGIPCDPLDMKGGHINDG FLTEDERLTPL


    Database link: Q9ESG4

  • Positive control

    • WB: Recombinant mouse Tmem27 protein; rat spleen lysate. IHC-P: Mouse kidney, stomach and uterus tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab239586 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 30 µg/ml.
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 25 kDa.

Target

  • Function

    Regulator of SNARE complex function. Stimulator of beta cell replication.
  • Tissue specificity

    Kidney; collecting ducts. Pancreas; beta cells of islets.
  • Sequence similarities

    Belongs to the TMEM27 family.
  • Post-translational
    modifications

    Glycosylated.
    The extracellular domain is cleaved and released from the cell membrane of pancreatic beta cells.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • UNQ679 antibody
    • Collectrin antibody
    • kidney-specific membrane protein antibody
    • NX-17 antibody
    • NX17 antibody
    • PRO1312 antibody
    • Tmem27 antibody
    • TMM27_HUMAN antibody
    • Transmembrane protein 27 antibody
    • UNQ679/PRO1312 antibody
    see all

Images

  • Anti-Tmem27 antibody [C7] (ab239586) at 5 µg/ml + Recombinant mouse Tmem27 protein

    Predicted band size: 25 kDa

  • Anti-Tmem27 antibody [C7] (ab239586) at 3 µg/ml + Rat spleen lysate

    Secondary
    HRP-Linked Rabbit Anti-Mouse IgG at 1/5000 dilution

    Predicted band size: 25 kDa

  • Paraffin-embedded mouse kidney tissue stained for Tmem27 using ab239586 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse stomach tissue stained for Tmem27 using ab239586 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse uterus tissue stained for Tmem27 using ab239586 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239586 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239586.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up