Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM43
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TMEM43 aa 178-312.
    Sequence:

    FMATAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYH SENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFST KSGDTLLLLHHGDFSAEEVFHRELRSNSMKTWGLR


    Database link: Q9BTV4

  • Positive control

    • WB: A549 whole cell lysate; Mouse brain and skeletal muscle tissue lysates. IHC-P: Human melanoma cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    May have an important role in maintaining nuclear envelope structure by organizing protein complexes at the inner nuclear membrane. Required for retaining emerin at the inner nuclear membrane.
  • Tissue specificity

    Highest expression in placenta. Also found at lower levels in heart, ovary, spleen, small intestine, thymus, prostate and testis.
  • Involvement in disease

    Defects in TMEM43 are the cause of familial arrhythmogenic right ventricular dysplasia type 5 (ARVD5) [MIM:604400]; also known as arrhythmogenic right ventricular cardiomyopathy (ARVC5). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
  • Sequence similarities

    Belongs to the TMEM43 family.
  • Cellular localization

    Endoplasmic reticulum. Nucleus inner membrane. Retained in the inner nuclear membrane through interaction with EMD and A-and B-lamins. The N- and C-termini are orientated towards the nucleoplasm. The majority of the hydrophilic domain resides in the endoplasmic reticulum lumen.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARVC5 antibody
    • ARVD5 antibody
    • EDMD7 antibody
    • LUMA antibody
    • Protein LUMA antibody
    • Tmem43 antibody
    • TMM43_HUMAN antibody
    • Transmembrane protein 43 antibody
    see all

Images

  • All lanes : Anti-TMEM43 antibody (ab224629) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : Mouse brain tissue lysate
    Lane 3 : Mouse skeletal muscle tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 45 kDa
    Observed band size: 45 kDa

  • Paraffin-embedded human melanoma cancer tissue stained for TMEM43 using ab224629 at 1/100 dilution in immunohistochemical analysis.

References

ab224629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up