Anti-TMEM43 antibody (ab230213)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-TMEM43 antibody
See all TMEM43 primary antibodies -
Description
Rabbit polyclonal to TMEM43 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Orangutan -
Immunogen
Recombinant fragment corresponding to Human TMEM43 aa 80-310.
Sequence:VAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEMYQWVETEE SREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFM ATAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSE NPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKS GDTLLLLHHGDFSAEEVFHRELRSNSMKTWG
Database link: Q9BTV4 -
Positive control
- IHC-P: Human placenta tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab230213 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. |
Target
-
Function
May have an important role in maintaining nuclear envelope structure by organizing protein complexes at the inner nuclear membrane. Required for retaining emerin at the inner nuclear membrane. -
Tissue specificity
Highest expression in placenta. Also found at lower levels in heart, ovary, spleen, small intestine, thymus, prostate and testis. -
Involvement in disease
Defects in TMEM43 are the cause of familial arrhythmogenic right ventricular dysplasia type 5 (ARVD5) [MIM:604400]; also known as arrhythmogenic right ventricular cardiomyopathy (ARVC5). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall. -
Sequence similarities
Belongs to the TMEM43 family. -
Cellular localization
Endoplasmic reticulum. Nucleus inner membrane. Retained in the inner nuclear membrane through interaction with EMD and A-and B-lamins. The N- and C-termini are orientated towards the nucleoplasm. The majority of the hydrophilic domain resides in the endoplasmic reticulum lumen. - Information by UniProt
-
Database links
- Entrez Gene: 79188 Human
- Entrez Gene: 74122 Mouse
- Entrez Gene: 100172804 Orangutan
- Entrez Gene: 362401 Rat
- Omim: 612048 Human
- SwissProt: Q9BTV4 Human
- SwissProt: Q9DBS1 Mouse
- SwissProt: Q5R9S8 Orangutan
see all -
Alternative names
- ARVC5 antibody
- ARVD5 antibody
- EDMD7 antibody
see all
Images
Datasheets and documents
References
ab230213 has not yet been referenced specifically in any publications.