Anti-TMEM43 antibody (ab230213)

Submit a review Submit a question

Key features and details

  • Rabbit polyclonal to TMEM43
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG

Overview

  • Product name

    Anti-TMEM43 antibody
    See all TMEM43 primary antibodies

  • Description

    Rabbit polyclonal to TMEM43

  • Host species

    Rabbit

  • Tested applications

    Suitable for: IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan

  • Immunogen

    Recombinant fragment corresponding to Human TMEM43 aa 80-310.
    Sequence:

    VAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEMYQWVETEE SREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFM ATAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSE NPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKS GDTLLLLHHGDFSAEEVFHRELRSNSMKTWG


    Database link: Q9BTV4

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human placenta tissue.

  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

Applications

Our Abpromise guarantee covers the use of ab230213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    May have an important role in maintaining nuclear envelope structure by organizing protein complexes at the inner nuclear membrane. Required for retaining emerin at the inner nuclear membrane.

  • Tissue specificity

    Highest expression in placenta. Also found at lower levels in heart, ovary, spleen, small intestine, thymus, prostate and testis.

  • Involvement in disease

    Defects in TMEM43 are the cause of familial arrhythmogenic right ventricular dysplasia type 5 (ARVD5) [MIM:604400]; also known as arrhythmogenic right ventricular cardiomyopathy (ARVC5). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.

  • Sequence similarities

    Belongs to the TMEM43 family.

  • Cellular localization

    Endoplasmic reticulum. Nucleus inner membrane. Retained in the inner nuclear membrane through interaction with EMD and A-and B-lamins. The N- and C-termini are orientated towards the nucleoplasm. The majority of the hydrophilic domain resides in the endoplasmic reticulum lumen.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • ARVC5 antibody
    • ARVD5 antibody
    • EDMD7 antibody
    • LUMA antibody
    • Protein LUMA antibody
    • Tmem43 antibody
    • TMM43_HUMAN antibody
    • Transmembrane protein 43 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM43 antibody (ab230213)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-TMEM43 antibody (ab230213)

    Paraffin-embedded human placenta tissue stained for TMEM43 using ab230213 at 1/100 dilution in immunohistochemical analysis.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

References (0)

Publishing research using ab230213? Please let us know so that we can cite the reference in this datasheet.

ab230213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab230213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com