Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM49/VMP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human TMEM49/VMP1 aa 1-50 (N terminal).
    Sequence:

    MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQP


    Database link: Q96GC9

  • Positive control

    • MCF7 cells.
  • General notes

     This product was previously labelled as TMEM49

     

Properties

Applications

Our Abpromise guarantee covers the use of ab221489 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Stress-induced protein that, when overexpressed, promotes formation of intracellular vacuoles followed by cell death. May be involved in the cytoplasmic vacuolization of acinar cells during the early stage of acute pancreatitis. Plays a role in the initial stages of the autophagic process through its interaction with BECN1 (By similarity). Involved in cell-cell adhesion. Plays an essential role in formation of cell junctions.
  • Sequence similarities

    Belongs to the VMP1 family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Cell membrane. Vacuole membrane. Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP566I133 antibody
    • ectopic P-granules autophagy protein 3 homolog antibody
    • NF E2 induceble protein 2 antibody
    • NF E2 inducible protein 2 antibody
    • ni 2 antibody
    • protein ni 2 antibody
    • Tango5 antibody
    • TDC1 antibody
    • TMEM49 antibody
    • Transmembrane protein 49 antibody
    • transport and golgi organization 5 homolog antibody
    • Vacuole membrane protein 1 antibody
    • vmp1 antibody
    • VMP1_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized MCF7 cells labeling TMEM49/VMP1 with ab221489 at 4 μg/ml (green).

References

ab221489 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221489.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up