Overview

  • Product name

  • Description

    Rabbit polyclonal to TMEM65
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human TMEM65 aa 63-240.
    Sequence:

    MEALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPTPG QLRYVFIHNAIPFIGFGFLDNAIMIVAGTHIEMSIGIILGISTMAAAALG NLVSDLAGLGLAGYVEALASRLGLSIPDLTPKQVDMWQTRLSTHLGKAVG VTIGCILGMFPLIFFGGGEEDEKLETKS


    Database link: Q6PI78

  • Positive control

    • WB: Mouse liver, kidney and gonadal tissue lysate. IHC-P: Human placenta and rectum tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 25 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-TMEM65 antibody (ab236861) at 1/500 dilution

    Lane 1 : Mouse liver lysate
    Lane 2 : Mouse kidney lysate
    Lane 3 : Mouse gonadal lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 25 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling TMEM65 using ab236861 at 1/100 dilution in ICC/IF. Secondary antibody was Alexa Fluor®488-conjugated goat anti-rabbit IgG (H+L). 

  • Paraffin-embedded human placenta tissue stained for TMEM65 using ab236861 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for TMEM65 using ab236861 at 1/100 dilution in immunohistochemical analysis.

References

ab236861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up