Overview

  • Product name

    Anti-TMEM81 antibody
  • Description

    Rabbit polyclonal to TMEM81
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human TMEM81 aa 167-221.
    Sequence:

    NLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPH HPKWK


    Database link: Q6P7N7

  • Positive control

    • WB - RT4 cell line lysate; U251 MG cell line lysate. ICC/IF - U2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
Recommended conditions:
Fixation/Permeabilization: PFA/Triton X-100
WB 1/250 - 1/500. Predicted molecular weight: 28 kDa.

Target

Images

  • All lanes : Anti-TMEM81 antibody (ab220726) at 1/250 dilution

    Lane 1 : RT4 cell line lysate
    Lane 2 : U251 MG cell line lysate

    Predicted band size: 28 kDa

  • Immunofluorescent analysis of PFA fixed, Triton X-100 permeabilized U2 OS cells labeling TMEM81 with ab220726 at 4 µg/ml (green).

References

ab220726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up