Overview

  • Product name

    Anti-TMEM91 antibody
  • Description

    Rabbit polyclonal to TMEM91
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human TMEM91 aa 1-97.
    Sequence:

    MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLG


    Database link: Q6ZNR0

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human liver cancer and small intestine tissues. ICC/IF: MCF7 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 18 kDa.
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    The function of this protein is unknown.
  • Cellular localization

    Membrane; Multi-pass membrane protein
  • Database links

  • Alternative names

    • FLJ27310 antibody
    • FLJ45695 antibody
    • Transmembrane protein 91 antibody

Images

  • Anti-TMEM91 antibody (ab236864) at 1/1000 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 18 kDa

  • Paraffin-embedded human liver cancer tissue stained for TMEM91 using ab236864 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for TMEM91 using ab236864 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for TMEM91 (green) using ab236864 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236864.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up