Overview

  • Product name

  • Description

    Rabbit polyclonal to TMLHE
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow
  • Immunogen

    Recombinant fragment corresponding to Human TMLHE.
    Sequence:

    IRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWVKLKPGRVL FIDNWRVLHGRECFTGYRQLCGCYLTRDDVLNTAR


    Database link: Q9NVH6

  • Positive control

    • HEK 293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220232 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML).
  • Tissue specificity

    All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle.
  • Pathway

    Amine and polyamine biosynthesis; carnitine biosynthesis.
  • Involvement in disease

    Autism, X-linked 6
  • Sequence similarities

    Belongs to the gamma-BBH/TMLD family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • AUTSX6 antibody
    • BBOX2 antibody
    • Butyrobetaine (gamma) 2 oxoglutarate dioxygenase (gamma butyrobetaine hydroxylase) 2 antibody
    • Epsilon-trimethyllysine 2-oxoglutarate dioxygenase antibody
    • Epsilon-trimethyllysine hydroxylase antibody
    • FLJ10727 antibody
    • TML dioxygenase antibody
    • TML hydroxylase antibody
    • TML-alpha-ketoglutarate dioxygenase antibody
    • TMLD antibody
    • TMLH antibody
    • TMLH_HUMAN antibody
    • TMLHE antibody
    • TMLHED antibody
    • Trimethyllysine dioxygenase, mitochondrial antibody
    • Trimethyllysine hydroxylase epsilon antibody
    • XAP130 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HEK 293 cells labeling TMHLE with ab220232 at 4 µg/ml (green).

References

ab220232 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220232.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up