Overview

  • Product name
    Anti-TMPRSS5 antibody [OTI4G4]
    See all TMPRSS5 primary antibodies
  • Description
    Mouse monoclonal [OTI4G4] to TMPRSS5
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMPRSS5 aa 1-457. Produced in HEK-293T cells (NP_110397).
    Sequence:

    MSLMLDDQPPMEAQYAEEGPGPGIFRAEPGDQQHPISQAVCWRSMRRGCA VLGALGLLAGAGVGSWLLVLYLCPAASQPISGTLQDEEITLSCSEASAEE ALLPALPKTVSFRINSEDFLLEAQVRDQPRWLLVCHEGWSPALGLQICWS LGHLRLTHHKGVNLTDIKLNSSQEFAQLSPRLGGFLEEAWQPRNNCTSGQ VVSLRCSECGARPLASRIVGGQSVAPGRWPWQASVALGFRHTCGGSVLAP RWVVTAAHCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLY SAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHT HPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADA CQGDSGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKVAEFLDWIHD TAQDSLL


    Database link: Q9H3S3

  • Positive control
    • WB: HEK-293T cells transfected with pCMV6-ENTRY TMPRSS5 cDNA. IHC-P: Human prostate tissue. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY TMPRSS5.
  • General notes

    Clone OTI4G4 (formerly 4G4).

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity
    Affinity purified
  • Purification notes
    Purified from cell culture supernatant by affinity chromatography.
  • Clonality
    Monoclonal
  • Clone number
    OTI4G4
  • Isotype
    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab139163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 50 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
ICC/IF 1/100.

Target

  • Function
    May play a role in hearing.
  • Tissue specificity
    Brain-specific. Predominantly expressed in neurons, in their axons, and at the synapses of motoneurons in the spinal cord.
  • Involvement in disease
    Note=Defects in TMPRSS5 may be a cause of deafness.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • MGC141886 antibody
    • MGC148044 antibody
    • OTTHUMP00000238209 antibody
    • OTTHUMP00000238210 antibody
    • OTTHUMP00000238211 antibody
    • OTTHUMP00000238212 antibody
    • OTTHUMP00000238213 antibody
    • Spinesin antibody
    • TMPRSS 5 antibody
    • TMPRSS5 antibody
    • TMPS5_HUMAN antibody
    • Transmembrane protease serine 5 antibody
    • Transmembrane protease, serine 5 (spinesin) antibody
    • Transmembrane protease, serine 5 antibody
    see all

Images

  • All lanes : Anti-TMPRSS5 antibody [OTI4G4] (ab139163) at 1/1000 dilution

    Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY TMPRSS5 cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 50 kDa

  • Paraffin-embedded human prostate tissue stained for TMPRSS5 with ab139163 at a 1/150 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH6.0, 120°C for 3 minutes.

  • pCMV6-ENTRY TMPRSS5 cDNA transfected COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for TMPRSS5 using ab139163 at a 1/100 dilution in ICC/IF.

References

ab139163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up