Overview

  • Product name

  • Description

    Rabbit polyclonal to TMS1/ASC
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human TMS1/ASC aa 1-195.
    Sequence:

    MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDAL DLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGI QAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVR AEPTNPSKMRKLFSFTPAWNWTCKDLLLQA LRESQSYLVEDLERS


    Database link: Q9ULZ3

  • Positive control

    • A549, THP1, HT29 and BT474 cell line extracts.
  • General notes

     This product was previously labelled as TMS1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab180799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

WB 1/500 - 1/2000. Predicted molecular weight: 22 kDa.

Target

  • Function

    Promotes caspase-mediated apoptosis. This proapoptotic activity is mediated predominantly through the activation of caspase-9. May be a component of the inflammasome, a protein complex which also includes NALP2, CARD8 and CASP1 and whose function would be the activation of proinflammatory caspases.
  • Tissue specificity

    Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Detected in the leukemia cell lines HL-60 and U937, but not in Jurkat T-cell lymphoma and Daudi Burkitt's lymphoma. Detected in the melanoma cell line WM35, but not in WM793. Not detected in HeLa cervical carcinoma cells and Molt 4 lymphocytic leukemia cells.
  • Sequence similarities

    Contains 1 CARD domain.
    Contains 1 DAPIN domain.
  • Domain

    Interacts with CIAS1/PYPAF1 and PYDC1 via the DAPIN domain.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cytoplasm. Upstream of caspase activation, a redistribution from the cytoplasm to the aggregates occurs. These appear as hollow, perinuclear spherical, ball-like structures.
  • Information by UniProt
  • Database links

  • Alternative names

    • Apoptosis associated speck like protein containing a CARD antibody
    • Apoptosis-associated speck-like protein containing a CARD antibody
    • ASC antibody
    • ASC_HUMAN antibody
    • CARD 5 antibody
    • CARD5 antibody
    • Caspase recruitment domain containing protein 5 antibody
    • Caspase recruitment domain protein 5 antibody
    • Caspase recruitment domain-containing protein 5 antibody
    • hASC antibody
    • MGC10332 antibody
    • PYCARD antibody
    • PYD and CARD domain containing antibody
    • PYD and CARD domain containing protein antibody
    • PYD and CARD domain-containing protein antibody
    • Target of methylation induced silencing 1 antibody
    • Target of methylation-induced silencing 1 antibody
    • TMS 1 antibody
    • TMS antibody
    • TMS1 antibody
    see all

Images

  • All lanes : Anti-TMS1/ASC antibody (ab180799) at 1/500 dilution

    Lane 1 : A549 cell line extract
    Lane 2 : THP1 cell line extract
    Lane 3 : HT29 cell line extract
    Lane 4 : BT474 cell line extract

    Predicted band size: 22 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of rat spleen tissue labelling TMS1/ASC with ab180799 at 1/200. Magnification: 400x.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human kidney tissue labelling TMS1/ASC with ab180799 at 1/200. Magnification: 200x.

  • Immunocytochemistry/Immunofluorescence analysis of HeLa cells using ab180799. Blue DAPI for nuclear staining.

References

This product has been referenced in:

  • Yeo AJ  et al. Increased susceptibility of airway epithelial cells from ataxia-telangiectasia to S. pneumoniae infection due to oxidative damage and impaired innate immunity. Sci Rep 9:2627 (2019). Read more (PubMed: 30796268) »
  • Chen H  et al. Enhanced Expression of NLRP3 Inflammasome-Related Inflammation in Diabetic Retinopathy. Invest Ophthalmol Vis Sci 59:978-985 (2018). Read more (PubMed: 29450537) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up